Reticulon-4 receptor-like 1 (Rtn4rl1) Recombinant Protein | Rtn4rl1 recombinant protein
Recombinant Mouse Reticulon-4 receptor-like 1 (Rtn4rl1)
Gene Names
Rtn4rl1; Ngr3; Ngrh2; Ngrl2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Reticulon-4 receptor-like 1 (Rtn4rl1); Recombinant Mouse Reticulon-4 receptor-like 1 (Rtn4rl1); Rtn4rl1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
25-424aa; full length protein
Sequence
CPRDCVCYPAPMTVSCQAHNFAAIPEGIPEDSERIFLQNNRITFLQQGHFSPAMVTLWIY SNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGI FGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLL HENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRAR SLWEWLRRFRGSSSAVPCATPELRQGQDLKLLRVEDFRNCTGPVSPHQIKSHTLTTSDRA ARKEHHPSHGASRDKGHPHGHPPGSRSGYKKAGKNCTSHRNRNQISKVSSGKELTELQDY APDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Rtn4rl1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,836 Da
NCBI Official Full Name
reticulon-4 receptor-like 1
NCBI Official Synonym Full Names
reticulon 4 receptor-like 1
NCBI Official Symbol
Rtn4rl1
NCBI Official Synonym Symbols
Ngr3; Ngrh2; Ngrl2
NCBI Protein Information
reticulon-4 receptor-like 1
UniProt Protein Name
Reticulon-4 receptor-like 1
Protein Family
UniProt Gene Name
Rtn4rl1
UniProt Synonym Gene Names
NgR3
UniProt Entry Name
R4RL1_MOUSE
Uniprot Description
RTN4RL1: May play a role in regulating axonal regeneration and plasticity in the adult central nervous system. Belongs to the Nogo receptor family.
Protein type: Membrane protein, GPI anchor; Membrane protein, integral
Cellular Component: anchored to plasma membrane; cell surface; cytoplasm; external side of plasma membrane; integral to membrane; lipid raft; membrane; plasma membrane
Molecular Function: protein kinase inhibitor activity; receptor activity
Biological Process: axon regeneration; cytokine and chemokine mediated signaling pathway; negative regulation of JAK-STAT cascade; negative regulation of protein kinase activity
Research Articles on Rtn4rl1
Similar Products
Product Notes
The Rtn4rl1 rtn4rl1 (Catalog #AAA7029166) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-424aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Rtn4rl1 rtn4rl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CPRDCVCYPA PMTVSCQAHN FAAIPEGIPE DSERIFLQNN RITFLQQGHF SPAMVTLWIY SNNITFIAPN TFEGFVHLEE LDLGDNRQLR TLAPETFQGL VKLHALYLYK CGLSALPAGI FGGLHSLQYL YLQDNHIEYL QDDIFVDLVN LSHLFLHGNK LWSLGQGIFR GLVNLDRLLL HENQLQWVHH KAFHDLHRLT TLFLFNNSLT ELQGDCLAPL VALEFLRLNG NAWDCGCRAR SLWEWLRRFR GSSSAVPCAT PELRQGQDLK LLRVEDFRNC TGPVSPHQIK SHTLTTSDRA ARKEHHPSHG ASRDKGHPHG HPPGSRSGYK KAGKNCTSHR NRNQISKVSS GKELTELQDY APDYQHKFSF DIMPTARPKR KGKCARRTPI RAPSGVQQAS. It is sometimes possible for the material contained within the vial of "Reticulon-4 receptor-like 1 (Rtn4rl1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
