Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3-epi-6-deoxocathasterone 23-monooxygenase (ROT3) Recombinant Protein | ROT3 recombinant protein

Recombinant Arabidopsis thaliana 3-epi-6-deoxocathasterone 23-monooxygenase (ROT3)

Gene Names
ROT3; AP22.10; AP22_10; CYP90C1; ROT3; ROTUNDIFOLIA 3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-epi-6-deoxocathasterone 23-monooxygenase (ROT3); Recombinant Arabidopsis thaliana 3-epi-6-deoxocathasterone 23-monooxygenase (ROT3); ROT3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-524aa; full length protein
Sequence
MQPPASAGLFRSPENLPWPYNYMDYLVAGFLVLTAGILLRPWLWLRLRNSKTKDGDEEED NEEKKKGMIPNGSLGWPVIGETLNFIACGYSSRPVTFMDKRKSLYGKVFKTNIIGTPIII STDAEVNKVVLQNHGNTFVPAYPKSITELLGENSILSINGPHQKRLHTLIGAFLRSPHLK DRITRDIEASVVLTLASWAQLPLVHVQDEIKKMTFEILVKVLMSTSPGEDMNILKLEFEE FIKGLICIPIKFPGTRLYKSLKAKERLIKMVKKVVEERQVAMTTTSPANDVVDVLLRDGG DSEKQSQPSDFVSGKIVEMMIPGEETMPTAMTLAVKFLSDNPVALAKLVEENMEMKRRKL ELGEEYKWTDYMSLSFTQNVINETLRMANIINGVWRKALKDVEIKGYLIPKGWCVLASFI SVHMDEDIYDNPYQFDPWRWDRINGSANSSICFTPFGGGQRLCPGLELSKLEISIFLHHL VTRYSWTAEEDEIVSFPTVKMKRRLPIRVATVDDSASPISLEDH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ROT3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,356 Da
NCBI Official Full Name
3-epi-6-deoxocathasterone 23-monooxygenase
NCBI Official Symbol
ROT3
NCBI Official Synonym Symbols
AP22.10; AP22_10; CYP90C1; ROT3; ROTUNDIFOLIA 3
NCBI Protein Information
3-epi-6-deoxocathasterone 23-monooxygenase
UniProt Protein Name
3-epi-6-deoxocathasterone 23-monooxygenase
UniProt Gene Name
ROT3
UniProt Synonym Gene Names
CYP90C1
UniProt Entry Name
C90C1_ARATH

NCBI Description

Encodes a cytochrome P-450 gene that is involved in leaf blade expansion by controlling polar cell expansion in the leaf length direction. Member of the CYP90C CYP450 family. ROT3 was shown to be involved in brassinosteroid biosynthesis, most likely in the conversion step of typhasterol (TY) to castasterone (CS). As 6-deoxo-CS was unable to restore the phenotype of rot3-1, it has been postulated that ROT3 might be specifically involved in the conversion of TY to CS in the C6-oxidation pathway of brassinolide. Recently, CYP90C1 was shown to catalyse the C-23 hydroxylation of several brassinosteroids (the enzyme has a broad specificity for 22-hydroxylated substrates).

Uniprot Description

C-23 hydroxylase involved in brassinosteroids biosynthesis. Converts directly (22S,24R)-22-hydroxy-5-alpha-ergostan-3-one and 3-epi-6-deoxocathasterone to 3-dehydro-6-deoxoteasterone and 6-deoxotyphasterol. These C-23 hydroxylation shortcuts bypass campestanol, 6-deoxocathasterone, and 6-deoxoteasterone. Functionally redundant with CYP90D1.

Research Articles on ROT3

Similar Products

Product Notes

The ROT3 rot3 (Catalog #AAA7029100) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-524aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ROT3 rot3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQPPASAGLF RSPENLPWPY NYMDYLVAGF LVLTAGILLR PWLWLRLRNS KTKDGDEEED NEEKKKGMIP NGSLGWPVIG ETLNFIACGY SSRPVTFMDK RKSLYGKVFK TNIIGTPIII STDAEVNKVV LQNHGNTFVP AYPKSITELL GENSILSING PHQKRLHTLI GAFLRSPHLK DRITRDIEAS VVLTLASWAQ LPLVHVQDEI KKMTFEILVK VLMSTSPGED MNILKLEFEE FIKGLICIPI KFPGTRLYKS LKAKERLIKM VKKVVEERQV AMTTTSPAND VVDVLLRDGG DSEKQSQPSD FVSGKIVEMM IPGEETMPTA MTLAVKFLSD NPVALAKLVE ENMEMKRRKL ELGEEYKWTD YMSLSFTQNV INETLRMANI INGVWRKALK DVEIKGYLIP KGWCVLASFI SVHMDEDIYD NPYQFDPWRW DRINGSANSS ICFTPFGGGQ RLCPGLELSK LEISIFLHHL VTRYSWTAEE DEIVSFPTVK MKRRLPIRVA TVDDSASPIS LEDH. It is sometimes possible for the material contained within the vial of "3-epi-6-deoxocathasterone 23-monooxygenase (ROT3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.