E3 ubiquitin protein ligase RIN2 (RIN2) Recombinant Protein | RIN2 recombinant protein
Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIN2 (RIN2)
Gene Names
RIN2; F24A6.70; F24A6_70; RIN2; RPM1 interacting protein 2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin protein ligase RIN2 (RIN2); Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIN2 (RIN2); RIN2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-578aa; full length protein
Sequence
MGIKYLPVSVASTALSFVGLQVWTELSLDRLRADGLIAKNISLGDSEHALELLLGSYFTI ALLTNFVLNVYILLVLSLKTLFFGDLYDVETKKLVERLANYIIYKGTFLPLVIPPTIFQG VLWTVWLTVLCTLKMFQALARDRLERLNASPSSTPWTYFRVYSVLFLVLSVDMFWIKLSL MTYNTIGSAVYLLLLFEPCSIAFETLQALLIHGFQLLDMWINHLAVKNSDCQRSKFIDSM TAGSLLEWKGLLNRNLGFFLDMATLVMALGHYLHIWWLHGIAFHLVDAVLFLNIRALLSA ILKRIKGYIKLRIALGALHAALPDATSEELRAYDDECAICREPMAKAKRLHCNHLFHLGC LRSWLDQGLNEVYSCPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQLERQNNPVHALAT GLFPAEVPDSVENDTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLAS VGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNIL AMAETVREVMPHVPDEIIFQDLQRTNSVAVTVNNLLQM
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RIN2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
64,564 Da
NCBI Official Full Name
E3 ubiquitin protein ligase RIN2
NCBI Official Symbol
RIN2
NCBI Official Synonym Symbols
F24A6.70; F24A6_70; RIN2; RPM1 interacting protein 2
NCBI Protein Information
E3 ubiquitin protein ligase RIN2
UniProt Protein Name
E3 ubiquitin protein ligase RIN2
Protein Family
UniProt Gene Name
RIN2
UniProt Synonym Gene Names
AMFR-1A
UniProt Entry Name
RIN2_ARATH
NCBI Description
RPM1 interacting protein 2, has a CUE domain which is sufficient for the interaction with RPM1.Positive regulator of RPM1 and PRS2 mediated hypersensitive response.Functions as ubiquitin ligase and binds to RPM1.
Uniprot Description
E3 ubiquitin protein ligase that acts as positive regulator of RPM1- and RPS2-dependent hypersensitive response (HR), in association with RIN3. Probably not required for RPM1 degradation during HR.
Research Articles on RIN2
Similar Products
Product Notes
The RIN2 rin2 (Catalog #AAA7028688) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-578aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RIN2 rin2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGIKYLPVSV ASTALSFVGL QVWTELSLDR LRADGLIAKN ISLGDSEHAL ELLLGSYFTI ALLTNFVLNV YILLVLSLKT LFFGDLYDVE TKKLVERLAN YIIYKGTFLP LVIPPTIFQG VLWTVWLTVL CTLKMFQALA RDRLERLNAS PSSTPWTYFR VYSVLFLVLS VDMFWIKLSL MTYNTIGSAV YLLLLFEPCS IAFETLQALL IHGFQLLDMW INHLAVKNSD CQRSKFIDSM TAGSLLEWKG LLNRNLGFFL DMATLVMALG HYLHIWWLHG IAFHLVDAVL FLNIRALLSA ILKRIKGYIK LRIALGALHA ALPDATSEEL RAYDDECAIC REPMAKAKRL HCNHLFHLGC LRSWLDQGLN EVYSCPTCRK PLFVGRTENE VNPRTVEVSS DEQLARQLER QNNPVHALAT GLFPAEVPDS VENDTSRNLG LDPSWLQTWS SQGSDVAGPS TTSRTVGLGR VQMMMRHLAS VGESYAQTAL DDAAWSLWPM NPSQASTSST TVPPGNGGRT GGLHLRTVSN TTNESLTNIL AMAETVREVM PHVPDEIIFQ DLQRTNSVAV TVNNLLQM. It is sometimes possible for the material contained within the vial of "E3 ubiquitin protein ligase RIN2 (RIN2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
