Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CAAX prenyl protease 2 (RCE1) Recombinant Protein | RCE1 recombinant protein

Recombinant Human CAAX prenyl protease 2 (RCE1)

Gene Names
RCE1; FACE2; RCE1A; RCE1B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CAAX prenyl protease 2 (RCE1); Recombinant Human CAAX prenyl protease 2 (RCE1); RCE1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-329aa; full length protein
Sequence
MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSEL PRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL LLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR ACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVF GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQ PLTDPKLYGSLPLCVLLERAGDSEAPLCS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for RCE1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,833 Da
NCBI Official Full Name
CAAX prenyl protease 2 isoform 2
NCBI Official Synonym Full Names
Ras converting CAAX endopeptidase 1
NCBI Official Symbol
RCE1
NCBI Official Synonym Symbols
FACE2; RCE1A; RCE1B
NCBI Protein Information
CAAX prenyl protease 2
UniProt Protein Name
CAAX prenyl protease 2
UniProt Gene Name
RCE1
UniProt Synonym Gene Names
FACE2; RCE1A; RCE1B; FACE-2; hRCE1
UniProt Entry Name
FACE2_HUMAN

NCBI Description

This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

RCE1: Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1. Belongs to the peptidase U48 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Protease; EC 3.4.22.-

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; integral to plasma membrane; membrane

Molecular Function: cysteine-type endopeptidase activity; endopeptidase activity; metalloendopeptidase activity

Biological Process: proteolysis

Research Articles on RCE1

Similar Products

Product Notes

The RCE1 rce1 (Catalog #AAA7028441) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-329aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the RCE1 rce1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAALGGDGLR LLSVSRPERP PESAALGGLG PGLCCWVSVF SCLSLACSYV GSLYVWKSEL PRDHPAVIKR RFTSVLVVSS LSPLCVLLWR ELTGIQPGTS LLTLMGFRLE GIFPAALLPL LLTMILFLGP LMQLSMDCPC DLADGLKVVL APRSWARCLT DMRWLRNQVI APLTEELVFR ACMLPMLAPC MGLGPAVFTC PLFFGVAHFH HIIEQLRFRQ SSVGNIFLSA AFQFSYTAVF GAYTAFLFIR TGHLIGPVLC HSFCNYMGFP AVCAALEHPQ RRPLLAGYAL GVGLFLLLLQ PLTDPKLYGS LPLCVLLERA GDSEAPLCS. It is sometimes possible for the material contained within the vial of "CAAX prenyl protease 2 (RCE1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.