Progestin and adipoQ receptor family member 3 (PAQR3) Recombinant Protein | PAQR3 recombinant protein
Recombinant Human Progestin and adipoQ receptor family member 3 (PAQR3)
Gene Names
PAQR3; RKTG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Progestin and adipoQ receptor family member 3 (PAQR3); Recombinant Human Progestin and adipoQ receptor family member 3 (PAQR3); PAQR3 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-311aa; full length protein
Sequence
MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCI KSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCML CSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLA MILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRV IVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRH SKPCPDYVSHL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for PAQR3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10,357 Da
NCBI Official Full Name
progestin and adipoQ receptor family member 3
NCBI Official Synonym Full Names
progestin and adipoQ receptor family member 3
NCBI Official Symbol
PAQR3
NCBI Official Synonym Symbols
RKTG
NCBI Protein Information
progestin and adipoQ receptor family member 3
UniProt Protein Name
Progestin and adipoQ receptor family member 3
Protein Family
UniProt Gene Name
PAQR3
UniProt Synonym Gene Names
RKTG
UniProt Entry Name
PAQR3_HUMAN
Uniprot Description
PAQR3: Functions as a spatial regulator of RAF1 kinase by sequestrating it to the Golgi. Belongs to the ADIPOR family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Receptor, misc.; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 4q21.21
Cellular Component: Golgi apparatus; Golgi membrane; integral to membrane
Molecular Function: receptor activity
Biological Process: MAPKKK cascade; negative regulation of MAP kinase activity; negative regulation of peptidyl-serine phosphorylation; negative regulation of protein amino acid phosphorylation; protein localization in Golgi apparatus
Research Articles on PAQR3
Similar Products
Product Notes
The PAQR3 paqr3 (Catalog #AAA7025354) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-311aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the PAQR3 paqr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MHQKLLKSAH YIELGSYQYW PVLVPRGIRL YTYEQIPGSL KDNPYITDGY RAYLPSRLCI KSLFILSNET VNIWSHLLGF FLFFTLGIYD MTSVLPSASA SREDFVICSI CLFCFQVCML CSVGYHLFSC HRSEKTCRRW MALDYAGISI GILGCYVSGV FYAFYCNNYW RQVYLITVLA MILAVFFAQI HPNYLTQQWQ RLRSIIFCSV SGYGVIPTLH WVWLNGGIGA PIVQDFAPRV IVMYMIALLA FLFYISKVPE RYFPGQLNYL GSSHQIWHIL AVVMLYWWHQ STVYVMQYRH SKPCPDYVSH L. It is sometimes possible for the material contained within the vial of "Progestin and adipoQ receptor family member 3 (PAQR3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
