Non-structural polyprotein 1AB (ORF1) Recombinant Protein | ORF1 recombinant protein
Recombinant Ovine astrovirus 1 Non-structural polyprotein 1AB (ORF1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Non-structural polyprotein 1AB (ORF1); Recombinant Ovine astrovirus 1 Non-structural polyprotein 1AB (ORF1); ORF1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
827-1351aa; full length protein
Sequence
QPKKLQRGPEDPGPEECKLDYWEQLVEPSKEKFLVPPEYPLLGVVPLDRPISDFDAPVDN LLALLPEPESPDLGFEPAVWGPEAYVKSFEKFDFADPDPNIEKNYPREWAFANLVLHREF DFLADSVVKDITATSKNSESTPGFPKTYWWKTEAEYLAKRGYADYVSEWNRIRGGARPNV LWYLFLKKEILKSTKVRDADIRQIICSDPIFARIGCCFEEDQNERMKRRTKTRMPQCGWS PFFGGFNDRIQRLVAKGNPYWIEFDWTRYDGTIPSQIFKHIKNFRFSMLAKEYQTPELRN MYHWYVDNILRRYVCMPSGEITIQHKGNPSGQVSTTMDNNLVNVFLQAFEYAYLHPEKSM DELRKDWESYDSLIYGDDRLTTSPSVPNDYVTRVVAMYKDIFGMWVKPEKVKVSHSPVGL SFCGFVITHQDGQYLPVPAEEAKLLASLLRPTKKLENMDALYGKLLCYRILNHNLPNDNK FRNYILVALEVMARHYSSRGEEPPFYVTESMLDKLWRGGPKFDYG
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Ovine astrovirus 1 (OAstV-1)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ORF1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
95,455 Da
NCBI Official Full Name
orf1ab polyprotein (orf1ab)
NCBI Official Symbol
OAstVgp1
NCBI Protein Information
orf1ab polyprotein (orf1ab); nonstructural protein, putative serine protase
UniProt Protein Name
Non-structural polyprotein 1AB
Protein Family
UniProt Gene Name
ORF1
UniProt Synonym Gene Names
p27; p57
UniProt Entry Name
NS1AB_OASV1
Uniprot Description
Non-structural polyprotein 1AB: contains the viral protease participating in the cleavage of the polyprotein into functional products. It contains also the activities necessary for replication of genomic RNA, as well as transcription of subgenomic mRNA.VPg: protein covalently attached to the 5' extremity of the genomic and subgenomic RNAs.
Similar Products
Product Notes
The ORF1 orf1 (Catalog #AAA7025178) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 827-1351aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ORF1 orf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QPKKLQRGPE DPGPEECKLD YWEQLVEPSK EKFLVPPEYP LLGVVPLDRP ISDFDAPVDN LLALLPEPES PDLGFEPAVW GPEAYVKSFE KFDFADPDPN IEKNYPREWA FANLVLHREF DFLADSVVKD ITATSKNSES TPGFPKTYWW KTEAEYLAKR GYADYVSEWN RIRGGARPNV LWYLFLKKEI LKSTKVRDAD IRQIICSDPI FARIGCCFEE DQNERMKRRT KTRMPQCGWS PFFGGFNDRI QRLVAKGNPY WIEFDWTRYD GTIPSQIFKH IKNFRFSMLA KEYQTPELRN MYHWYVDNIL RRYVCMPSGE ITIQHKGNPS GQVSTTMDNN LVNVFLQAFE YAYLHPEKSM DELRKDWESY DSLIYGDDRL TTSPSVPNDY VTRVVAMYKD IFGMWVKPEK VKVSHSPVGL SFCGFVITHQ DGQYLPVPAE EAKLLASLLR PTKKLENMDA LYGKLLCYRI LNHNLPNDNK FRNYILVALE VMARHYSSRG EEPPFYVTES MLDKLWRGGP KFDYG. It is sometimes possible for the material contained within the vial of "Non-structural polyprotein 1AB (ORF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
