Putative odorant receptor 65c (Or65c) Recombinant Protein | Or65c recombinant protein
Recombinant Drosophila melanogaster Putative odorant receptor 65c (Or65c)
Gene Names
Or65c; 65c; CG32403; DmelCG32403; DOR65; LU27.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative odorant receptor 65c (Or65c); Recombinant Drosophila melanogaster Putative odorant receptor 65c (Or65c); Or65c recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-410aa; full length protein
Sequence
MDIRGNVHRFVKFYIDGWKHFRDPTMESSYSAVYYWREQMKAMFLYTTSKERQMPYRSSW HTLVIIQATVCFLTMCYGVTESLGDKVQMGRDIAFIIGFFYIAFKIYYFQWYGDELDEVV EALETFHPWAQKGPGAVDYRTAKRWYFTLAFFLASSWLVFLCIFILLLITSPLWVHQQIL PLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLSVSIYVEITFAIEVLC LELRHLHQRCHGYEQLRLETNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVNFFLVSLSV LEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEAYDPIKGSKD VYRDLCLIIRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFLLKTLD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Or65c recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,236 Da
NCBI Official Full Name
odorant receptor 65c
NCBI Official Synonym Full Names
Odorant receptor 65c
NCBI Official Symbol
Or65c
NCBI Official Synonym Symbols
65c; CG32403; DmelCG32403; DOR65; LU27.3
NCBI Protein Information
CG32403 gene product from transcript CG32403-RA
UniProt Protein Name
Putative odorant receptor 65c
Protein Family
UniProt Gene Name
Or65c
UniProt Entry Name
OR65C_DROME
Uniprot Description
Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability ().
Similar Products
Product Notes
The Or65c or65c (Catalog #AAA7025046) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-410aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Or65c or65c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDIRGNVHRF VKFYIDGWKH FRDPTMESSY SAVYYWREQM KAMFLYTTSK ERQMPYRSSW HTLVIIQATV CFLTMCYGVT ESLGDKVQMG RDIAFIIGFF YIAFKIYYFQ WYGDELDEVV EALETFHPWA QKGPGAVDYR TAKRWYFTLA FFLASSWLVF LCIFILLLIT SPLWVHQQIL PLHAAFPFQW HEKSIHPISH AFIYLFQTWN VMYFLTWLVC IEGLSVSIYV EITFAIEVLC LELRHLHQRC HGYEQLRLET NRLVQFHQKI VHILDHTNKV FHGTLIMQMG VNFFLVSLSV LEAMEARKDP KVVAQFAVLM LLALGHLSMW SYFGDLLSQK SLTISEAAYE AYDPIKGSKD VYRDLCLIIR RGQEPLIMRA SPFPSFNFIN YSAILNQCYG ILTFLLKTLD. It is sometimes possible for the material contained within the vial of "Putative odorant receptor 65c (Or65c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
