Octopamine receptor beta-2R (Octbeta2R) Recombinant Protein | Octbeta2R recombinant protein
Recombinant Drosophila melanogaster Octopamine receptor beta-2R (Octbeta2R)
Gene Names
Octbeta2R; anon-WO0170980.184; anon-WO0170980.185; CG18553; CG33976; CG6989; DmCG6989; DmelCG33976; DmOctbeta2R; Dm_3R:45121; OctB2R; OctBeta2; octbeta2R; Octbeta2r
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Octopamine receptor beta-2R (Octbeta2R); Recombinant Drosophila melanogaster Octopamine receptor beta-2R (Octbeta2R); Octbeta2R recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-536aa; full length protein
Sequence
MLLCDGLGPEPPRQRHRNRTSAARIRKRPKCCCGDGGSGNQAEQPGGIVSNPISYGQSLT TLARVTAAALTTAAMLHTTNALAATGSSSASNSSTGGIALPLGTATPATHELNATQPFGG SGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMR VRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTAS ILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQ QFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRHGNAM LMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTF ILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTL LCLFCNWWKDRHLPLDIDIRRSSLRYDQRAKSVYSESYLNSTTPSHRRQSQMVDNL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Octbeta2R recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,379 Da
NCBI Official Full Name
octopamine beta2 receptor, isoform A
NCBI Official Synonym Full Names
Octopamine beta2 receptor
NCBI Official Symbol
Octbeta2R
NCBI Official Synonym Symbols
anon-WO0170980.184; anon-WO0170980.185; CG18553; CG33976; CG6989; DmCG6989; DmelCG33976; DmOctbeta2R; Dm_3R:45121; OctB2R; OctBeta2; octbeta2R; Octbeta2r
NCBI Protein Information
CG33976 gene product from transcript CG33976-RG
UniProt Protein Name
Octopamine receptor beta-2R
Protein Family
UniProt Gene Name
Octbeta2R
UniProt Synonym Gene Names
DmOct-beta-12; DmOct-beta-2R
UniProt Entry Name
OCTB2_DROME
Uniprot Description
Autoreceptor for octopamine (OA), which is a neurotransmitter, neurohormone, and neuromodulator in invertebrates (PubMed:15998303, PubMed:21186359). Essential for ovulation and fertilization (PubMed:25099506, PubMed:25353988). During ovulation it mediates the OA-induced relaxation of the oviduct visceral muscles, by increasing cAMP levels and activating effectors such as calmodulin-dependent kinase II (CaMKII) and cAMP-dependent protein kinase A (PKA) pathways (PubMed:25353988). Positively regulates synaptic growth; an action that is antagonized by Octbeta1R (PubMed:21186359, PubMed:22553037).
Research Articles on Octbeta2R
Similar Products
Product Notes
The Octbeta2R octbeta2r (Catalog #AAA7024333) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-536aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Octbeta2R octbeta2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLLCDGLGPE PPRQRHRNRT SAARIRKRPK CCCGDGGSGN QAEQPGGIVS NPISYGQSLT TLARVTAAAL TTAAMLHTTN ALAATGSSSA SNSSTGGIAL PLGTATPATH ELNATQPFGG SGLNFNESGA GLSDHHHHQQ HNPDEDWLDN IVWVFKAFVM LLIIIAAICG NLLVIISVMR VRKLRVITNY FVVSLAMADI MVAIMAMTFN FSVQVTGRWN FSPFLCDLWN SLDVYFSTAS ILHLCCISVD RYYAIVKPLK YPISMTKRVV GIMLLNTWIS PALLSFLPIF IGWYTTPQHQ QFVIQNPTQC SFVVNKYYAV ISSSISFWIP CTIMIFTYLA IFREANRQEK QLMMRHGNAM LMHRPSMQPS GEALSGSGSS KTLTLHEVEQ EHTPTKDKHL IKMKREHKAA RTLGIIMGTF ILCWLPFFLW YTLSMTCEEC QVPDIVVSIL FWIGYFNSTL NPLIYAYFNR DFREAFRNTL LCLFCNWWKD RHLPLDIDIR RSSLRYDQRA KSVYSESYLN STTPSHRRQS QMVDNL. It is sometimes possible for the material contained within the vial of "Octopamine receptor beta-2R (Octbeta2R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
