Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Na(+)-translocating NADH-quinone reductase subunit C (nqrC) Recombinant Protein | nqrC recombinant protein

Recombinant Vibrio cholerae serotype O1 Na(+)-translocating NADH-quinone reductase subunit C

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Na(+)-translocating NADH-quinone reductase subunit C (nqrC); Recombinant Vibrio cholerae serotype O1 Na(+)-translocating NADH-quinone reductase subunit C; nqrC recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-257aa; full length protein
Sequence
ASNNDSIKKTLFVVIALSLVCSIIVSAAAVGLRDKQKENAALDKQSKILQVAGIEAKGSK QIVELFNKSIEPRLVDFNTGDFVEGDAANYDQRKAAKEASESIKLTAEQDKAKIQRRANV GVVYLVKDGDKTSKVILPVHGNGLWSMMYAFVAVETDGNTVSGLTYYEQGETPGLGGEVE NPAWRAQWVGKKLFDENHKPAIKIVKGGAPQGSEHGVDGLSGATLTSNGVQNTFDFWLGD MGFGPFLTKVRDGGLN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for nqrC recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,619 Da
NCBI Official Full Name
NADH:ubiquinone reductase (Na(+)-transporting) subunit C
UniProt Protein Name
Na(+)-translocating NADH-quinone reductase subunit C
UniProt Gene Name
nqrC
UniProt Synonym Gene Names
Na(+)-NQR subunit C; Na(+)-translocating NQR subunit C
UniProt Entry Name
NQRC_VIBC3

Uniprot Description

NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na+ ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol.

Similar Products

Product Notes

The nqrC nqrc (Catalog #AAA7023488) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-257aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the nqrC nqrc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASNNDSIKKT LFVVIALSLV CSIIVSAAAV GLRDKQKENA ALDKQSKILQ VAGIEAKGSK QIVELFNKSI EPRLVDFNTG DFVEGDAANY DQRKAAKEAS ESIKLTAEQD KAKIQRRANV GVVYLVKDGD KTSKVILPVH GNGLWSMMYA FVAVETDGNT VSGLTYYEQG ETPGLGGEVE NPAWRAQWVG KKLFDENHKP AIKIVKGGAP QGSEHGVDGL SGATLTSNGV QNTFDFWLGD MGFGPFLTKV RDGGLN. It is sometimes possible for the material contained within the vial of "Na(+)-translocating NADH-quinone reductase subunit C (nqrC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.