Aquaporin NIP6-1 (NIP6-1) Recombinant Protein | NIP6-1 recombinant protein
Recombinant Arabidopsis thaliana Aquaporin NIP6-1 (NIP6-1)
Gene Names
NIP6;1; ATNIP6; F23A5.11; F23A5_11; NIP6; NIP6;1; NLM7; NOD26-like intrinsic protein 6;1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aquaporin NIP6-1 (NIP6-1); Recombinant Arabidopsis thaliana Aquaporin NIP6-1 (NIP6-1); NIP6-1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-305aa; full length protein
Sequence
MDHEEIPSTPSTPATTPGTPGAPLFGGFEGKRNGHNGRYTPKSLLKSCKCFSVDNEWALE DGRLPPVTCSLPPPNVSLYRKLGAEFVGTLILIFAGTATAIVNQKTDGAETLIGCAASAG LAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVMASVSAAFALKAVFE PTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAGIAVGATVMLNILI AGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTIVKLPEEDEAPKER RSFRR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for NIP6-1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,845 Da
NCBI Official Full Name
aquaporin NIP6-1
NCBI Official Symbol
NIP6;1
NCBI Official Synonym Symbols
ATNIP6; F23A5.11; F23A5_11; NIP6; NIP6;1; NLM7; NOD26-like intrinsic protein 6;1
NCBI Protein Information
aquaporin NIP6-1
UniProt Protein Name
Aquaporin NIP6-1
Protein Family
UniProt Gene Name
NIP6-1
UniProt Synonym Gene Names
AtNIP6;1
UniProt Entry Name
NIP61_ARATH
NCBI Description
Encodes a protein with boron transporter activity. It helps to preferentially direct boron to young developing tissues in the shoot, such as immature leaves, under low boron conditions. This boron channel appears to be impermeable to water, unlike the closely related NIP5;1 boron transporter. This protein also allows the transport of glycerol, urea, and formimide but not larger uncharged solutes such as arabitol and sucrose when it is expressed heterologously.
Uniprot Description
Transports glycerol, urea and formamide, in Xenopus laevis oocytes. Very low water transport activity.
Research Articles on NIP6-1
Similar Products
Product Notes
The NIP6-1 nip6-1 (Catalog #AAA7023345) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-305aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the NIP6-1 nip6-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDHEEIPSTP STPATTPGTP GAPLFGGFEG KRNGHNGRYT PKSLLKSCKC FSVDNEWALE DGRLPPVTCS LPPPNVSLYR KLGAEFVGTL ILIFAGTATA IVNQKTDGAE TLIGCAASAG LAVMIVILST GHISGAHLNP AVTIAFAALK HFPWKHVPVY IGAQVMASVS AAFALKAVFE PTMSGGVTVP TVGLSQAFAL EFIISFNLMF VVTAVATDTR AVGELAGIAV GATVMLNILI AGPATSASMN PVRTLGPAIA ANNYRAIWVY LTAPILGALI GAGTYTIVKL PEEDEAPKER RSFRR. It is sometimes possible for the material contained within the vial of "Aquaporin NIP6-1 (NIP6-1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
