Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme (ninaA) Recombinant Protein | ninaA recombinant protein
Recombinant Drosophila melanogaster Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme (ninaA)
Gene Names
ninaA; CG3966; DmelCG3966; ninA; NinaA; NINAA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptidyl-prolyl cis-trans isomerase; rhodopsin-specific isozyme (ninaA); Recombinant Drosophila melanogaster Peptidyl-prolyl cis-trans isomerase; ninaA recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-237aa; full length protein
Sequence
LSFTVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRV VDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYV TTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTEQFEFYP DDFNILGWIKAAGLPVTSSFCVLLIFHYFFRQLNMYC
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ninaA recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,351 Da
NCBI Official Full Name
neither inactivation nor afterpotential A
NCBI Official Synonym Full Names
neither inactivation nor afterpotential A
NCBI Official Symbol
ninaA
NCBI Official Synonym Symbols
CG3966; DmelCG3966; ninA; NinaA; NINAA
NCBI Protein Information
CG3966 gene product from transcript CG3966-RA
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme
Protein Family
UniProt Gene Name
ninaA
UniProt Synonym Gene Names
PPIase
UniProt Entry Name
CYPR_DROME
Uniprot Description
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts on the folding of rhodopsin RH1 and RH2 (but not RH3) and is required for visual transduction.
Similar Products
Product Notes
The ninaA ninaa (Catalog #AAA7023311) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-237aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ninaA ninaa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LSFTVTSRIY MDVKHNKKPV GRITFGLFGK LAPKTVANFR HICLRGINGT SYVGSRFHRV VDRFLVQGGD IVNGDGTGSI SIYGDYFPDE DKALAVEHNR PGYLGMANRG PDTNGCQFYV TTVGAKWLDG KHTVFGKVLE GMDTIYAIED VKTDTDDFPV EPVVISNCGE IPTEQFEFYP DDFNILGWIK AAGLPVTSSF CVLLIFHYFF RQLNMYC. It is sometimes possible for the material contained within the vial of "Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme (ninaA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
