Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (Ndufa13) Recombinant Protein | Ndufa13 recombinant protein

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (Ndufa13)

Gene Names
Ndufa13; CDA016; CGI-39; Grim19; GRIM-19; AU022060; 2700054G14Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (Ndufa13); Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (Ndufa13); Ndufa13 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-144aa; full length protein
Sequence
AASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIFGYWRMMRWNQERRRLL IEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESVFHTTRWVPPLI GEMYGLRTKEEMSNANFGFTWYT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ndufa13 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,860 Da
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
NCBI Official Symbol
Ndufa13
NCBI Official Synonym Symbols
CDA016; CGI-39; Grim19; GRIM-19; AU022060; 2700054G14Rik
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Protein Family
UniProt Gene Name
Ndufa13
UniProt Synonym Gene Names
Grim19; CI-B16.6; GRIM-19; Gene associated with retinoic and IFN-induced mortality 19 protein
UniProt Entry Name
NDUAD_MOUSE

Uniprot Description

GRIM-19: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes. Defects in NDUFA13 may be a cause of susceptibility to Hurthle cell thyroid carcinoma (HCTC). Hurthle cell thyroid carcinoma accounts for approximately 3% of all thyroid cancers. Although they are classified as variants of follicular neoplasms, they are more often multifocal and somewhat more aggressive and are less likely to take up iodine than are other follicular neoplasms. Belongs to the complex I NDUFA13 subunit family.

Protein type: Mitochondrial; Oxidoreductase; Membrane protein, integral

Cellular Component: cytoplasm; mitochondrial inner membrane; mitochondrial membrane; mitochondrial respiratory chain; mitochondrial respiratory chain complex I; mitochondrion; nucleoplasm; nucleus

Molecular Function: ATP binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity

Biological Process: negative regulation of cell growth; negative regulation of transcription, DNA-dependent; positive regulation of caspase activity; positive regulation of protein catabolic process; protein import into mitochondrial inner membrane

Research Articles on Ndufa13

Similar Products

Product Notes

The Ndufa13 ndufa13 (Catalog #AAA7023210) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-144aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ndufa13 ndufa13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AASKVKQDMP PPGGYGPIDY KRNLPRRGLS GYSMFAVGIG ALIFGYWRMM RWNQERRRLL IEDLEARIAL MPLFQAEKDR RTLQILRENL EEEAIIMKDV PNWKVGESVF HTTRWVPPLI GEMYGLRTKE EMSNANFGFT WYT. It is sometimes possible for the material contained within the vial of "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (Ndufa13), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.