Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lipid A export ATP-binding/permease protein MsbA (msbA) Recombinant Protein | msbA recombinant protein

Recombinant Neisseria gonorrhoeae Lipid A export ATP-binding/permease protein MsbA (msbA)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipid A export ATP-binding/permease protein MsbA (msbA); Recombinant Neisseria gonorrhoeae Lipid A export ATP-binding/permease protein MsbA (msbA); msbA recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-622aa; full length protein
Sequence
MIEKLTFGLFKKEDARSFMRLMAYVRPYKIRIVAALIAIFGVAATESYLAAFIAPLINHG FSAPAAPPDLSAAAGILSTLQNWREQFTYMVWGTENKIWTVPLFLIILVVIRGICRFTST YLMTWVSVMTISKIRKDMFAKMLTLSSRYHQETPSGTVLMNMLNLTEQSVSNASDIFTVL TRDTMIVTGLTIVLLYLNWQLSLIVVLMFPLLSLLSRYYRDRLKHVISDSQKSIGTMNNV IAETHQGHRVVKLFNGQAQAANRFDAVNRTIVRLSKKITQATAAHSPFSELIASIALAVV IFIALWQSQNGYTTIGEFMAFIVAMLQMYAPIKSLANISIPMQTMFLAADGVCAFLDTPP EQDKGTLAPQRVEGRISFRNVDVEYRSDGIKALDNFNLDIRQGERVALVGRSGSGKSTVV NLLPRFVEPSAGNICIDGIDIADIKLDCLRAQFALVSQDVFLFDDTLFENVRYSRPDAGE AEVLSALQAANLQSLIDASPLGLHQPIGSNGSNLSGGQRQRVAIARAILKDAPILLLDEA TSALDNESERLVQQALERLMENRTGIIVAHRLTTVESADRIIVMDGGKIIEQGTHDQLMF QNGYYTMLRNISGKDTAAVQTA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for msbA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,803 Da
NCBI Official Full Name
lipid A export ATP-binding/permease MsbA
NCBI Official Symbol
NGO2165
NCBI Protein Information
lipid A ABC transporter ATP-binding protein/permease
UniProt Protein Name
Lipid A export ATP-binding/permease protein MsbA
UniProt Gene Name
msbA
UniProt Entry Name
MSBA_NEIG1

Uniprot Description

Involved in lipid A export and possibly also in glycerophospholipid export and for biogenesis of the outer membrane. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation.

Similar Products

Product Notes

The msbA msba (Catalog #AAA7020911) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-622aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the msbA msba for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MIEKLTFGLF KKEDARSFMR LMAYVRPYKI RIVAALIAIF GVAATESYLA AFIAPLINHG FSAPAAPPDL SAAAGILSTL QNWREQFTYM VWGTENKIWT VPLFLIILVV IRGICRFTST YLMTWVSVMT ISKIRKDMFA KMLTLSSRYH QETPSGTVLM NMLNLTEQSV SNASDIFTVL TRDTMIVTGL TIVLLYLNWQ LSLIVVLMFP LLSLLSRYYR DRLKHVISDS QKSIGTMNNV IAETHQGHRV VKLFNGQAQA ANRFDAVNRT IVRLSKKITQ ATAAHSPFSE LIASIALAVV IFIALWQSQN GYTTIGEFMA FIVAMLQMYA PIKSLANISI PMQTMFLAAD GVCAFLDTPP EQDKGTLAPQ RVEGRISFRN VDVEYRSDGI KALDNFNLDI RQGERVALVG RSGSGKSTVV NLLPRFVEPS AGNICIDGID IADIKLDCLR AQFALVSQDV FLFDDTLFEN VRYSRPDAGE AEVLSALQAA NLQSLIDASP LGLHQPIGSN GSNLSGGQRQ RVAIARAILK DAPILLLDEA TSALDNESER LVQQALERLM ENRTGIIVAH RLTTVESADR IIVMDGGKII EQGTHDQLMF QNGYYTMLRN ISGKDTAAVQ TA. It is sometimes possible for the material contained within the vial of "Lipid A export ATP-binding/permease protein MsbA (msbA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.