Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

2-acylglycerol O-acyltransferase 1 (MOGAT1) Recombinant Protein | MOGAT1 recombinant protein

Recombinant Human 2-acylglycerol O-acyltransferase 1 (MOGAT1)

Gene Names
MOGAT1; MGAT1; DGAT2L; DGAT2L1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
2-acylglycerol O-acyltransferase 1 (MOGAT1); Recombinant Human 2-acylglycerol O-acyltransferase 1 (MOGAT1); MOGAT1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-335aa; full length protein
Sequence
MKVEFAPLNIQLARRLQTVAVLQWVLKYLLLGPMSIGITVMLIIHNYLFLYIPYLMWLYF DWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFG NFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGN ISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPE GSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQE QIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MOGAT1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,812 Da
NCBI Official Full Name
2-acylglycerol O-acyltransferase 1
NCBI Official Synonym Full Names
monoacylglycerol O-acyltransferase 1
NCBI Official Symbol
MOGAT1
NCBI Official Synonym Symbols
MGAT1; DGAT2L; DGAT2L1
NCBI Protein Information
2-acylglycerol O-acyltransferase 1
UniProt Protein Name
2-acylglycerol O-acyltransferase 1
UniProt Gene Name
MOGAT1
UniProt Synonym Gene Names
DC2; DGAT2L1; MGAT1; hDC2
UniProt Entry Name
MOGT1_HUMAN

NCBI Description

Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM, Mar 2008]

Uniprot Description

MOGAT1: Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine. Belongs to the diacylglycerol acyltransferase family.

Protein type: EC 2.3.1.22; Membrane protein, integral; Membrane protein, multi-pass; Transferase; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 2q36.1

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: 2-acylglycerol O-acyltransferase activity; diacylglycerol O-acyltransferase activity

Biological Process: diacylglycerol biosynthetic process; glycerol metabolic process; triacylglycerol biosynthetic process

Similar Products

Product Notes

The MOGAT1 mogat1 (Catalog #AAA7020613) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-335aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MOGAT1 mogat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKVEFAPLNI QLARRLQTVA VLQWVLKYLL LGPMSIGITV MLIIHNYLFL YIPYLMWLYF DWHTPERGGR RSSWIKNWTL WKHFKDYFPI HLIKTQDLDP SHNYIFGFHP HGIMAVGAFG NFSVNYSDFK DLFPGFTSYL HVLPLWFWCP VFREYVMSVG LVSVSKKSVS YMVSKEGGGN ISVIVLGGAK ESLDAHPGKF TLFIRQRKGF VKIALTHGAS LVPVVSFGEN ELFKQTDNPE GSWIRTVQNK LQKIMGFALP LFHARGVFQY NFGLMTYRKA IHTVVGRPIP VRQTLNPTQE QIEELHQTYM EELRKLFEEH KGKYGIPEHE TLVLK. It is sometimes possible for the material contained within the vial of "2-acylglycerol O-acyltransferase 1 (MOGAT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.