Latent membrane protein 1 (LMP1) Recombinant Protein | LMP1 recombinant protein
Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Latent membrane protein 1 (LMP1); Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1); LMP1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-371aa; full length protein
Sequence
EHDLERGPPGPRRPPRGPPLSSSLGLALLLLLLALLFWLYIVMSDWTGGALLVLYSFALI LIIIILIIFIFRRDLLCPLGALCLLLLMITLLLIALWNLHGQALYLGIVLFIFGCLLVLG LWIYLLEILWRLGATIWQLLAFFLAFFLDLILLIIALYLQQNWWTLLVDLLWLLLFLAIL IWMYYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVTGAGDGPPLCSQN LGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTDDNGPQDPDNTADNGPHDPL PHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDP HGPVQLSYYD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for LMP1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,473 Da
NCBI Official Full Name
LMP-1
NCBI Official Symbol
HHV4tp2_gp80
NCBI Protein Information
LMP-1
UniProt Protein Name
Latent membrane protein 1
Protein Family
UniProt Gene Name
LMP1
UniProt Synonym Gene Names
LMP-1
UniProt Entry Name
LMP1_EBVA8
Uniprot Description
Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses.
Similar Products
Product Notes
The LMP1 lmp1 (Catalog #AAA7018927) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-371aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the LMP1 lmp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EHDLERGPPG PRRPPRGPPL SSSLGLALLL LLLALLFWLY IVMSDWTGGA LLVLYSFALI LIIIILIIFI FRRDLLCPLG ALCLLLLMIT LLLIALWNLH GQALYLGIVL FIFGCLLVLG LWIYLLEILW RLGATIWQLL AFFLAFFLDL ILLIIALYLQ QNWWTLLVDL LWLLLFLAIL IWMYYHGQRH SDEHHHDDSL PHPQQATDDS GHESDSNSNE GRHHLLVTGA GDGPPLCSQN LGAPGGGPDN GPQDPDNTDD NGPQDPDNTD DNGPQDPDNT DDNGPQDPDN TADNGPHDPL PHNPSDSAGN DGGPPNLTEE VENKGGDRGP PSMTDGGGGD PHLPTLLLGT SGSGGDDDDP HGPVQLSYYD. It is sometimes possible for the material contained within the vial of "Latent membrane protein 1 (LMP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
