Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Leukotoxin translocation ATP-binding protein LktB (lktB) Recombinant Protein | lktB recombinant protein

Recombinant Pasteurella haemolytica Leukotoxin translocation ATP-binding protein LktB (lktB)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukotoxin translocation ATP-binding protein LktB (lktB); Recombinant Pasteurella haemolytica Leukotoxin translocation ATP-binding protein LktB (lktB); lktB recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-708aa; full length protein
Sequence
MEANHQRNDLGLVALTMLAQYHNISLNPEEIKHKFDLDGKGLSLTAWLLAAKSLALKAKH IKKEISRLHLVNLPALVWQDNGKHFLLVKVDTDNNRYLTYNLEQDAPQILSQDEFEACYQ GQLILVTSRASVVGQLAKFDFTWFIPAVIKYRKIFLETLIVSIFLQIFALITPLFFQVVM DKVLVHRGFSTLNIITVALAIVIIFEIVLSGLRTYVFSHSTSRIDVELGAKLFRHLLSLP ISYFENRRVGDTVARVRELDQIRNFLTGQALTSVLDLLFSFIFFAVMWYYSPKLTLVILG SLPCYILWSIFISPILRRRLDEKFARSADNQAFLVESVTAINMIKAMAVAPQMTDTWDKQ LASYVSSSFRVTVLATIGQQGVQLIQKTVMVINLWLGAHLVISGDLSIGQLIAFNMLSGQ VIAPVIRLAQLWQDFQQVGISVTRLGDVLNSPTEQYQGKLSLPEIKGDISFKNIRFRYKP DAPTILNNVNLEIRQGEVIGIVGRSGSGKSTLTKLLQRFYIPENGQVLIDGHDLALADPN WLRRQIGVVLQDNVLLNRSIRENIALSDPGMPMERVIYAAKLAGAHDFISELREGYNTIV GEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHIIMQNMQKICQGRTVIL IAHRLSTVKNADRIIVMEKGEIVEQGKHHELLQNSNGLYSYLHQLQLN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Pasteurella haemolytica (Mannheimia haemolytica)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for lktB recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,697 Da
NCBI Official Full Name
leukotoxin translocation ATP-binding protein LktB
NCBI Official Symbol
MHH_RS17180
NCBI Protein Information
leukotoxin translocation ATP-binding protein LktB
UniProt Protein Name
Leukotoxin translocation ATP-binding protein LktB
UniProt Gene Name
lktB
UniProt Entry Name
LKB1B_MANHA

Uniprot Description

Part of the ABC transporter complex LktBD involved in leukotoxin export. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation (Probable).

Similar Products

Product Notes

The lktB lktb (Catalog #AAA7018918) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-708aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the lktB lktb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEANHQRNDL GLVALTMLAQ YHNISLNPEE IKHKFDLDGK GLSLTAWLLA AKSLALKAKH IKKEISRLHL VNLPALVWQD NGKHFLLVKV DTDNNRYLTY NLEQDAPQIL SQDEFEACYQ GQLILVTSRA SVVGQLAKFD FTWFIPAVIK YRKIFLETLI VSIFLQIFAL ITPLFFQVVM DKVLVHRGFS TLNIITVALA IVIIFEIVLS GLRTYVFSHS TSRIDVELGA KLFRHLLSLP ISYFENRRVG DTVARVRELD QIRNFLTGQA LTSVLDLLFS FIFFAVMWYY SPKLTLVILG SLPCYILWSI FISPILRRRL DEKFARSADN QAFLVESVTA INMIKAMAVA PQMTDTWDKQ LASYVSSSFR VTVLATIGQQ GVQLIQKTVM VINLWLGAHL VISGDLSIGQ LIAFNMLSGQ VIAPVIRLAQ LWQDFQQVGI SVTRLGDVLN SPTEQYQGKL SLPEIKGDIS FKNIRFRYKP DAPTILNNVN LEIRQGEVIG IVGRSGSGKS TLTKLLQRFY IPENGQVLID GHDLALADPN WLRRQIGVVL QDNVLLNRSI RENIALSDPG MPMERVIYAA KLAGAHDFIS ELREGYNTIV GEQGAGLSGG QRQRIAIARA LVNNPKILIF DEATSALDYE SEHIIMQNMQ KICQGRTVIL IAHRLSTVKN ADRIIVMEKG EIVEQGKHHE LLQNSNGLYS YLHQLQLN. It is sometimes possible for the material contained within the vial of "Leukotoxin translocation ATP-binding protein LktB (lktB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.