Lysosomal-associated transmembrane protein 5 (Laptm5) Recombinant Protein | Laptm5 recombinant protein

Recombinant Mouse Lysosomal-associated transmembrane protein 5 (Laptm5)

Cat. Num. AAA7018187

• Gene Names: Laptm5; E3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Lysosomal-associated transmembrane protein 5 (Laptm5); Recombinant Mouse Lysosomal-associated transmembrane protein 5 (Laptm5); Laptm5 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-261aa; full length protein
• Sequence: MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRM ADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAY LKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPH SQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEE ALSLPPKTPEGDPAPPPYSEV
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Mouse
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for Laptm5 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 6754504
• NCBI GeneID: 16792
• NCBI Accession #: NP_034816.1
• NCBI GenBank Nucleotide #: NM_010686.3
• UniProt Accession #: Q61168; Q60923
• Molecular Weight: 29,602 Da
• NCBI Official Full Name: lysosomal-associated transmembrane protein 5
• NCBI Official Synonym Full Names: lysosomal-associated protein transmembrane 5
• NCBI Official Symbol: Laptm5
• NCBI Official Synonym Symbols: E3
• NCBI Protein Information: lysosomal-associated transmembrane protein 5
• UniProt Protein Name: Lysosomal-associated transmembrane protein 5
• Protein Family: Lysosomal-associated transmembrane protein
• UniProt Gene Name: Laptm5
• UniProt Entry Name: LAPM5_MOUSE

Uniprot Description

LAPTM5: May have a special functional role during embryogenesis and in adult hematopoietic cells. Belongs to the LAPTM4/LAPTM5 transporter family.

Protein type: Vesicle; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: integral to membrane; integral to plasma membrane; lysosomal membrane; lysosome; membrane

Biological Process: transport