Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CTD nuclear envelope phosphatase 1 homolog (l(1)G0269) Recombinant Protein | l(1)G0269 recombinant protein

Recombinant Drosophila pseudoobscura pseudoobscura CTD nuclear envelope phosphatase 1 homolog (l (1)G0269)

Gene Names
DpseGA14238; dpse_GLEANR_11628; GA14238
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CTD nuclear envelope phosphatase 1 homolog (l(1)G0269); Recombinant Drosophila pseudoobscura pseudoobscura CTD nuclear envelope phosphatase 1 homolog (l (1)G0269); l(1)G0269 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-243aa; full length protein
Sequence
MISLLQMKFHALLLLLSKVWTCICFMFNRQVRAFIQYQPVKYELFPLSPVSRHRLSLVQR KTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVV SQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNR IFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVLSRNLHLH RLW
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila pseudoobscura pseudoobscura (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for l(1)G0269 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,467 Da
NCBI Official Full Name
uncharacterized protein Dpse_GA14238, isoform A
NCBI Official Symbol
DpseGA14238
NCBI Official Synonym Symbols
dpse_GLEANR_11628; GA14238
NCBI Protein Information
GA14238 gene product from transcript GA14238-RA
UniProt Protein Name
CTD nuclear envelope phosphatase 1 homolog
UniProt Gene Name
l(1)G0269
UniProt Entry Name
CNEP1_DROPS

Uniprot Description

Serine/threonine protein phosphatase that may dephosphorylate and activate lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol ().

Similar Products

Product Notes

The l(1)G0269 l(1)g0269 (Catalog #AAA7018153) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-243aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the l(1)G0269 l(1)g0269 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MISLLQMKFH ALLLLLSKVW TCICFMFNRQ VRAFIQYQPV KYELFPLSPV SRHRLSLVQR KTLVLDLDET LIHSHHNAMP RNTVKPGTPH DFTVKVTIDR NPVRFFVHKR PHVDYFLDVV SQWYDLVVFT ASMEIYGAAV ADKLDNGRNI LRRRYYRQHC TPDYGSYTKD LSAICSDLNR IFIIDNSPGA YRCFPNNAIP IKSWFSDPMD TALLSLLPML DALRFTNDVR SVLSRNLHLH RLW. It is sometimes possible for the material contained within the vial of "CTD nuclear envelope phosphatase 1 homolog (l(1)G0269), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.