Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1) Recombinant Protein | KCNQ1 recombinant protein

Recombinant Guinea pig Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1); Recombinant Guinea pig Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1); KCNQ1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-169aa; Full length protein
Sequence
GTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVL CVGSKGQVFATSAIRGIRFLQSLRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGL IFSSYFVYLAEKDAVNESGRVEFGSYADALWWGVVTVTTIGYGDKVPQT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Guinea Pig
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for KCNQ1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
74,411 Da
NCBI Official Full Name
Potassium voltage-gated channel subfamily KQT member 1
UniProt Protein Name
Potassium voltage-gated channel subfamily KQT member 1
UniProt Gene Name
KCNQ1
UniProt Entry Name
KCNQ1_CAVPO

Uniprot Description

Potassium channel that plays an important role in a number of tissues, including heart, inner ear, stomach and colon (). Associates with KCNE beta subunits that modulates current kinetics (). Induces a voltage-dependent by rapidly activating and slowly deactivating potassium-selective outward current (). Promotes also a delayed voltage activated potassium current showing outward rectification characteristic (). During beta-adrenergic receptor stimulation participates in cardiac repolarization by associating with KCNE1 to form the I(Ks) cardiac potassium current that increases the amplitude and slows down the activation kinetics of outward potassium current I(Ks) (). Muscarinic agonist oxotremorine-M strongly suppresses KCNQ1/KCNE1 current (). When associated with KCNE3, forms the potassium channel that is important for cyclic AMP-stimulated intestinal secretion of chloride ions (). This interaction with KCNE3 is reduced by 17beta-estradiol, resulting in the reduction of currents (). During conditions of increased substrate load, maintains the driving force for proximal tubular and intestinal sodium ions absorption, gastric acid secretion, and cAMP-induced jejunal chloride ions secretion (). Allows the provision of potassium ions to the luminal membrane of the secretory canaliculus in the resting state as well as during stimulated acid secretion (). When associated with KCNE2, forms a heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current (). When associated with KCNE4, inhibits voltage-gated potassium channel activity (). When associated with KCNE5, this complex only conducts current upon strong and continued depolarization (). Also forms a heterotetramer with KCNQ5 that has a voltage-gated potassium channel activity (). Binds with phosphatidylinositol 4,5-bisphosphate ().

Similar Products

Product Notes

The KCNQ1 kcnq1 (Catalog #AAA7017771) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-169aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the KCNQ1 kcnq1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GTLFWMEIVL VVFFGTEYVV RLWSAGCRSK YVGIWGRLRF ARKPISIIDL IVVVASMVVL CVGSKGQVFA TSAIRGIRFL QSLRMLHVDR QGGTWRLLGS VVFIHRQELI TTLYIGFLGL IFSSYFVYLA EKDAVNESGR VEFGSYADAL WWGVVTVTTI GYGDKVPQT. It is sometimes possible for the material contained within the vial of "Potassium voltage-gated channel subfamily KQT member 1 (KCNQ1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.