Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Intermediate conductance calcium-activated potassium channel protein 4 (Kcnn4) Recombinant Protein | Kcnn4 recombinant protein

Recombinant Rat Intermediate conductance calcium-activated potassium channel protein 4 (Kcnn4)

Gene Names
Kcnn4; rSK4; KCa3.1; rKCNN4c
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intermediate conductance calcium-activated potassium channel protein 4 (Kcnn4); Recombinant Rat Intermediate conductance calcium-activated potassium channel protein 4 (Kcnn4); Kcnn4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-425aa; full length protein
Sequence
MGGELVTGLGALRRRKRLLEQEKRVAGWALVLAGTGIGLMVLHAEMLWFLGCKWVLYLLL VKCLITLSTAFLLCLIVVFHAKEVQLFMTDNGLRDWRVALTRRQVAQILLELLVCGVHPV PLRSPHCTLAGEATDSQAWPGFLGEGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSI GALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLTDTLW LIPITFLTIGYGDVVPGTLWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM MDIHYAKEMKESAARLLQEAWMYYKHTRRKDSRAARRHQRKMLAAIHTFRQVRLKHRKLR EQVNSMVDISKMHMILCDLQLGLSASHLALEKRIDGLAGKLDALTELLSTALQQQQPPEP IQEAT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Kcnn4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
47,767 Da
NCBI Official Full Name
Intermediate conductance calcium-activated potassium channel protein 4
NCBI Official Synonym Full Names
potassium calcium-activated channel subfamily N member 4
NCBI Official Symbol
Kcnn4
NCBI Official Synonym Symbols
rSK4; KCa3.1; rKCNN4c
NCBI Protein Information
intermediate conductance calcium-activated potassium channel protein 4
UniProt Protein Name
Intermediate conductance calcium-activated potassium channel protein 4
UniProt Gene Name
Kcnn4
UniProt Synonym Gene Names
Ik1; Sk4; Smik; SK4; SKCa 4; SKCa4
UniProt Entry Name
KCNN4_RAT

NCBI Description

ion channel that exhibits intermediate conductance [RGD, Feb 2006]

Uniprot Description

KCNN4: Forms a voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells. The channel is blocked by clotrimazole and charybdotoxin but is insensitive to apamin. Belongs to the potassium channel KCNN family. KCa3.1/KCNN4 subfamily.

Protein type: Channel, potassium; Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: apical plasma membrane; basolateral plasma membrane; cell soma; integral to membrane; lipid raft; plasma membrane

Molecular Function: calcium-activated potassium channel activity; calmodulin binding; Intermediate conductance calcium-activated potassium channel activity; potassium channel activity; protein phosphatase binding; small conductance calcium-activated potassium channel activity

Biological Process: anion transport; calcium ion transport; cell volume homeostasis; immune system process; phospholipid translocation; positive regulation of protein secretion; positive regulation of T cell receptor signaling pathway; potassium ion transport; saliva secretion; stabilization of membrane potential

Research Articles on Kcnn4

Similar Products

Product Notes

The Kcnn4 kcnn4 (Catalog #AAA7017769) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-425aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Kcnn4 kcnn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGGELVTGLG ALRRRKRLLE QEKRVAGWAL VLAGTGIGLM VLHAEMLWFL GCKWVLYLLL VKCLITLSTA FLLCLIVVFH AKEVQLFMTD NGLRDWRVAL TRRQVAQILL ELLVCGVHPV PLRSPHCTLA GEATDSQAWP GFLGEGEALL SLAMLLRLYL VPRAVLLRSG VLLNASYRSI GALNQVRFRH WFVAKLYMNT HPGRLLLGLT LGLWLTTAWV LSVAERQAVN ATGHLTDTLW LIPITFLTIG YGDVVPGTLW GKIVCLCTGV MGVCCTALLV AVVARKLEFN KAEKHVHNFM MDIHYAKEMK ESAARLLQEA WMYYKHTRRK DSRAARRHQR KMLAAIHTFR QVRLKHRKLR EQVNSMVDIS KMHMILCDLQ LGLSASHLAL EKRIDGLAGK LDALTELLST ALQQQQPPEP IQEAT. It is sometimes possible for the material contained within the vial of "Intermediate conductance calcium-activated potassium channel protein 4 (Kcnn4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.