Potassium channel subfamily K member 13 (KCNK13) Recombinant Protein | KCNK13 recombinant protein

Recombinant Human Potassium channel subfamily K member 13 (KCNK13)

Cat. Num. AAA7017732

• Gene Names: KCNK13; THIK1; THIK-1; K2p13.1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Potassium channel subfamily K member 13 (KCNK13); Recombinant Human Potassium channel subfamily K member 13 (KCNK13); KCNK13 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-408aa; full length protein
• Sequence: MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANF SRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPAT VGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAG QCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGF GDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCP QCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASL AILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for KCNK13 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 16306555
• NCBI GeneID: 56659
• NCBI Accession #: NP_071337.2
• NCBI GenBank Nucleotide #: NM_022054.3
• UniProt Accession #: Q9HB14; Q96E79; B5TJL8
• Molecular Weight: 45,391 Da
• NCBI Official Full Name: potassium channel subfamily K member 13
• NCBI Official Synonym Full Names: potassium two pore domain channel subfamily K member 13
• NCBI Official Symbol: KCNK13
• NCBI Official Synonym Symbols: THIK1; THIK-1; K2p13.1
• NCBI Protein Information: potassium channel subfamily K member 13
• UniProt Protein Name: Potassium channel subfamily K member 13
• Protein Family: Potassium channel subfamily
• UniProt Gene Name: KCNK13
• UniProt Synonym Gene Names: THIK-1
• UniProt Entry Name: KCNKD_HUMAN

NCBI Description

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a potassium channel containing two pore-forming domains. This protein is an open channel that can be stimulated by arachidonic acid and inhibited by the anesthetic halothane. [provided by RefSeq, Jul 2013]

Uniprot Description

KCNK13: Potassium channel displaying weak inward rectification in symmetrical K(+) solution. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 14q32.11

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: potassium channel activity; potassium ion leak channel activity; voltage-gated ion channel activity

Biological Process: stabilization of membrane potential