T-cell immunomodulatory protein (Itfg1) Recombinant Protein | Itfg1 recombinant protein
Recombinant Mouse T-cell immunomodulatory protein (Itfg1)
Gene Names
Itfg1; Cda08; AI314457; D8Wsu49e; 2310047C21Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
T-cell immunomodulatory protein (Itfg1); Recombinant Mouse T-cell immunomodulatory protein (Itfg1); Itfg1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
33-610aa; full length protein
Sequence
LHNVTAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQSAPYFKPKVKVSL KTLSALVTSVVPGDYDGDSQMDVLLTYFPQNHTNSELGAVIFWGQNQTLDPKNMTILNRT FHDQPLIMDFNGDLIPDVFGITNESSQPQILLGGDLSWHPALTTKSKMRDPHSHAFIDLT EDFTADLFLTTLTASNAFQFEIWENLGGNFSIHSVFEKPKNLVVVGQSAFADFDGDGHMD HLLPGCEDKDCQKSAIYLMRSGTGQWVPVLQDFSNKGTLWGFVPFVHEEQPTTIPIPLTL HIGDYNMDGYPDALAILKNTSGSNQQAFLLENVPCNNASCEEVHRMFKVYWDLAGLNLIK DAIVATFFDIYEDGILDIIVLSKGYTKNDVAIHTLKNNFEADAYFVKVIVLSGLCSNDCP RKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDH LFVGIPRPSGEKSIRKQEWTAIIPNSQLIVIPYPHNVPRSWSAKLYLTPSNIVLLTAVAL IGVCIFILAIIAILHWQEKKADDREKRQEAHRFHFDAM
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Itfg1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
67,465 Da
NCBI Official Full Name
T-cell immunomodulatory protein
NCBI Official Synonym Full Names
integrin alpha FG-GAP repeat containing 1
NCBI Official Symbol
Itfg1
NCBI Official Synonym Symbols
Cda08; AI314457; D8Wsu49e; 2310047C21Rik
NCBI Protein Information
T-cell immunomodulatory protein
UniProt Protein Name
T-cell immunomodulatory protein
Protein Family
UniProt Gene Name
Itfg1
UniProt Synonym Gene Names
Protein TIP
UniProt Entry Name
TIP_MOUSE
Uniprot Description
ITFG1: Modulator of T-cell function. Has a protective effect in graft versus host disease model. Belongs to the TIP family.
Protein type: Membrane protein, integral
Cellular Component: extracellular region; integral to membrane; membrane
Molecular Function: protein binding
Similar Products
Product Notes
The Itfg1 itfg1 (Catalog #AAA7017549) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-610aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Itfg1 itfg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LHNVTAELFG AEAWGTLAAF GDLNSDKQTD LFVLRERNDL IVFLADQSAP YFKPKVKVSL KTLSALVTSV VPGDYDGDSQ MDVLLTYFPQ NHTNSELGAV IFWGQNQTLD PKNMTILNRT FHDQPLIMDF NGDLIPDVFG ITNESSQPQI LLGGDLSWHP ALTTKSKMRD PHSHAFIDLT EDFTADLFLT TLTASNAFQF EIWENLGGNF SIHSVFEKPK NLVVVGQSAF ADFDGDGHMD HLLPGCEDKD CQKSAIYLMR SGTGQWVPVL QDFSNKGTLW GFVPFVHEEQ PTTIPIPLTL HIGDYNMDGY PDALAILKNT SGSNQQAFLL ENVPCNNASC EEVHRMFKVY WDLAGLNLIK DAIVATFFDI YEDGILDIIV LSKGYTKNDV AIHTLKNNFE ADAYFVKVIV LSGLCSNDCP RKITPFGVNQ PGPYIMYTTV DANGYLKNGS AGQLSQSAHL ALQLPYNVLG LGRSANFLDH LFVGIPRPSG EKSIRKQEWT AIIPNSQLIV IPYPHNVPRS WSAKLYLTPS NIVLLTAVAL IGVCIFILAI IAILHWQEKK ADDREKRQEA HRFHFDAM. It is sometimes possible for the material contained within the vial of "T-cell immunomodulatory protein (Itfg1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
