Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 2A (Htr2a) Recombinant Protein | Htr2a recombinant protein

Recombinant Mouse 5-hydroxytryptamine receptor 2A (Htr2a)

Gene Names
Htr2a; Htr2; Htr-2; E030013E04
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 2A (Htr2a); Recombinant Mouse 5-hydroxytryptamine receptor 2A (Htr2a); Htr2a recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-471aa; Full length protein
Sequence
MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV
Sequence Length
471
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Htr2a recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,842 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 2A
NCBI Official Synonym Full Names
5-hydroxytryptamine (serotonin) receptor 2A
NCBI Official Symbol
Htr2a
NCBI Official Synonym Symbols
Htr2; Htr-2; E030013E04
NCBI Protein Information
5-hydroxytryptamine receptor 2A
UniProt Protein Name
5-hydroxytryptamine receptor 2A
UniProt Gene Name
Htr2a
UniProt Synonym Gene Names
Htr2; 5-HT-2; 5-HT-2A
UniProt Entry Name
5HT2A_MOUSE

Uniprot Description

5-HT(2A): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. This receptor is involved in tracheal smooth muscle contraction, bronchoconstriction, and control of aldosterone production. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral

Cellular Component: cell projection; cell soma; cytoplasm; cytoplasmic vesicle; cytosol; dendrite; dendritic shaft; integral to membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: drug binding; G-protein alpha-subunit binding; G-protein coupled receptor activity; protein complex binding; serotonin binding; serotonin receptor activity; signal transducer activity

Biological Process: artery smooth muscle contraction; behavior; behavioral response to cocaine; cell death; cellular calcium ion homeostasis; detection of mechanical stimulus involved in sensory perception of pain; detection of temperature stimulus involved in sensory perception of pain; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; memory; negative regulation of potassium ion transport; negative regulation of synaptic transmission, glutamatergic; phosphoinositide 3-kinase cascade; phospholipase C activation; positive regulation of cell proliferation; positive regulation of fat cell differentiation; positive regulation of glycolysis; positive regulation of kinase activity; positive regulation of MAP kinase activity; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of phosphatidylinositol biosynthetic process; positive regulation of vasoconstriction; regulation of behavior; regulation of dopamine secretion; regulation of hormone secretion; release of sequestered calcium ion into cytosol; response to drug; sensory perception of pain; serotonin receptor signaling pathway; serotonin receptor, phospholipase C activating pathway; signal transduction; sleep; smooth muscle contraction; thermoregulation; urinary bladder smooth muscle contraction

Research Articles on Htr2a

Similar Products

Product Notes

The Htr2a htr2a (Catalog #AAA7017285) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-471aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Htr2a htr2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEILCEDNIS LSSIPNSLMQ LGDDSRLYPN DFNSRDANTS EASNWTIDAE NRTNLSCEGY LPPTCLSILH LQEKNWSALL TTVVIILTIA GNILVIMAVS LEKKLQNATN YFLMSLAIAD MLLGFLVMPV SMLTILYGYR WPLPSKLCAV WIYLDVLFST ASIMHLCAIS LDRYVAIQNP IHHSRFNSRT KAFLKIIAVW TISVGISMPI PVFGLQDDSK VFKEGSCLLA DDNFVLIGSF VAFFIPLTIM VITYFLTIKS LQKEATLCVS DLSTRAKLSS FSFLPQSSLS SEKLFQRSIH REPGSYAGRR TMQSISNEQK ACKVLGIVFF LFVVMWCPFF ITNIMAVICK ESCNENVIGA LLNVFVWIGY LSSAVNPLVY TLFNKTYRSA FSRYIQCQYK ENRKPLQLIL VNTIPTLAYK SSQLQVGQKK NSQEDAEPTA NDCSMVTLGN QHSEEMCTDN IETVNEKVSC V. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 2A (Htr2a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.