Gustatory receptor 5a for trehalose (Gr5a) Recombinant Protein | Gr5a recombinant protein
Recombinant Drosophila melanogaster Gustatory receptor 5a for trehalose (Gr5a)
Gene Names
Gr5a; CG15779; Dmel5a; DmelCG15779; Gr5; GR5a; GR5A; Gr5A1; GRLU.7; GrLU7; han; LU.7; tre; Tre
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gustatory receptor 5a for trehalose (Gr5a); Recombinant Drosophila melanogaster Gustatory receptor 5a for trehalose (Gr5a); Gr5a recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-444aa; full length protein
Sequence
MRQLKGRNRCNRAVRHLKIQGKMWLKNLKSGLEQIRESQVRGTRKNFLHDGSFHEAVAPV LAVAQCFCLMPVCGISAPTYRGLSFNRRSWRFWYSSLYLCSTSVDLAFSIRRVAHSVLDV RSVEPIVFHVSILIASWQFLNLAQLWPGLMRHWAAVERRLPGYTCCLQRARPARRLKLVA FVLLVVSLMEHLLSIISVVYYDFCPRRSDPVESYLLGASAQLFEVFPYSNWLAWLGKIQN VLLTFGWSYMDIFLMMLGMGLSEMLARLNRSLEQQVRQPMPEAYWTWSRTLYRSIVELIR EVDDAVSGIMLISFGSNLYFICLQLLKSINTMPSSAHAVYFYFSLLFLLSRSTAVLLFVS AINDQAREPLRLLRLVPLKGYHPEVFRFAAELASDQVALTGLKFFNVTRKLFLAMAGTVA TYELVLIQFHEDKKTWDCSPFNLD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gr5a recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,169 Da
NCBI Official Full Name
gustatory receptor 5a
NCBI Official Synonym Full Names
Gustatory receptor 5a
NCBI Official Symbol
Gr5a
NCBI Official Synonym Symbols
CG15779; Dmel5a; DmelCG15779; Gr5; GR5a; GR5A; Gr5A1; GRLU.7; GrLU7; han; LU.7; tre; Tre
NCBI Protein Information
CG15779 gene product from transcript CG15779-RA
UniProt Protein Name
Gustatory receptor 5a for trehalose
Protein Family
UniProt Gene Name
Gr5a
UniProt Synonym Gene Names
GRLU.7; Tre
UniProt Entry Name
GR05A_DROME
Uniprot Description
Gustatory receptor required for response to the sugar trehalose in taste neurons. Gr5a neurons selectively respond to sugars, in contrast to Gr66a cells which respond to bitter compounds. Flies are attracted to sugars and avoid bitter substances, suggesting that Gr5a neuron activity is sufficient to mediate acceptance behavior. Sugar signal transduction occurs through coupling with G-proteins such as Galpha49B and G-salpha60A.
Research Articles on Gr5a
Similar Products
Product Notes
The Gr5a gr5a (Catalog #AAA7016334) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-444aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gr5a gr5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRQLKGRNRC NRAVRHLKIQ GKMWLKNLKS GLEQIRESQV RGTRKNFLHD GSFHEAVAPV LAVAQCFCLM PVCGISAPTY RGLSFNRRSW RFWYSSLYLC STSVDLAFSI RRVAHSVLDV RSVEPIVFHV SILIASWQFL NLAQLWPGLM RHWAAVERRL PGYTCCLQRA RPARRLKLVA FVLLVVSLME HLLSIISVVY YDFCPRRSDP VESYLLGASA QLFEVFPYSN WLAWLGKIQN VLLTFGWSYM DIFLMMLGMG LSEMLARLNR SLEQQVRQPM PEAYWTWSRT LYRSIVELIR EVDDAVSGIM LISFGSNLYF ICLQLLKSIN TMPSSAHAVY FYFSLLFLLS RSTAVLLFVS AINDQAREPL RLLRLVPLKG YHPEVFRFAA ELASDQVALT GLKFFNVTRK LFLAMAGTVA TYELVLIQFH EDKKTWDCSP FNLD. It is sometimes possible for the material contained within the vial of "Gustatory receptor 5a for trehalose (Gr5a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
