Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative Golgi pH regulator C (GPR89C) Recombinant Protein | GPR89C recombinant protein

Recombinant Human Putative Golgi pH regulator C (GPR89C)

Gene Names
GPR89A; GPHR; GPR89; SH120; GPR89B; UNQ192
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative Golgi pH regulator C (GPR89C); Recombinant Human Putative Golgi pH regulator C (GPR89C); GPR89C recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-320aa; Full length protein
Sequence
MFLGILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQ TMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALE ELSRQLFLETADLYATKERIEYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGK TDPVTRGIEITVNYLGIQFDVKFWSQHISFILVGIIIVTSIRGLLITLTKFFYAISSSKS SNVIVLLLAQIMGMYFVSSVLLIRMSMPLEYRTIITEVLGELQFNFYHRWFDVIFLVSAL SSILFLYLAHKQAPEKQMAP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GPR89C recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,917 Da
NCBI Official Full Name
Golgi pH regulator A isoform 1
NCBI Official Synonym Full Names
G protein-coupled receptor 89A
NCBI Official Symbol
GPR89A
NCBI Official Synonym Symbols
GPHR; GPR89; SH120; GPR89B; UNQ192
NCBI Protein Information
Golgi pH regulator A
UniProt Protein Name
Golgi pH regulator B
UniProt Gene Name
GPR89B
UniProt Synonym Gene Names
GPHRB; GPR89C
UniProt Entry Name
GPHRB_HUMAN

NCBI Description

GPR89A is a nearly identical copy of the GPR89B gene (MIM 612806).[supplied by OMIM, Jun 2009]

Uniprot Description

GPR89B: Voltage dependent anion channel required for acidification and functions of the Golgi apparatus that may function in counter-ion conductance. Belongs to the Golgi pH regulator (TC 1.A.38) family. Homotrimer

Protein type: Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: voltage-gated ion channel activity

Biological Process: ion transport; protein transport

Similar Products

Product Notes

The GPR89C gpr89b (Catalog #AAA7016271) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-320aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GPR89C gpr89b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFLGILSIEQ LISRVGVIGV TLMALLSGFG AVNCPYTYMS YFLRNVTDTD ILALERRLLQ TMDMIISKKK RMAMARRTMF QKGEVHNKPS GFWGMIKSVT TSASGSENLT LIQQEVDALE ELSRQLFLET ADLYATKERI EYSKTFKGKY FNFLGYFFSI YCVWKIFMAT INIVFDRVGK TDPVTRGIEI TVNYLGIQFD VKFWSQHISF ILVGIIIVTS IRGLLITLTK FFYAISSSKS SNVIVLLLAQ IMGMYFVSSV LLIRMSMPLE YRTIITEVLG ELQFNFYHRW FDVIFLVSAL SSILFLYLAH KQAPEKQMAP. It is sometimes possible for the material contained within the vial of "Putative Golgi pH regulator C (GPR89C), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.