Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

G-protein coupled receptor 56 (Gpr56) Recombinant Protein | Gpr56 recombinant protein

Recombinant Rat G-protein coupled receptor 56 (Gpr56)

Gene Names
Adgrg1; Gpr56
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G-protein coupled receptor 56 (Gpr56); Recombinant Rat G-protein coupled receptor 56 (Gpr56); Gpr56 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
26-687aa; full length protein
Sequence
ASPREDFRFCGQRNQTQQSTLHYDQTSEPHIFVWNTDESLTIRAPFPAAPDIPYFFPEPR GLYHFCLYWSRHTGRLHLRYGKNDYLLSSRASNLLCYRKQEESLKQGAPLVATSVSSWQS PQNTSLPGAPSFIFSFHNAPHKVSHNASVNMCDLKKELQLLSKFLQHPHKASKRPSAAFI SQQLQNLESKLTSVSFLGDTLSFEENRVNATVWKLPPTAGLEDLQIHSQQEEEQSEVQAY SVLLPRAVFQQTRGRRRDAAKRLLVVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVTNL SDPVVLTFQHQPQPKNVTLQCVFWVEDPASSSTGSWSSEGCETVSRDTQTSCLCNHLTYF AVLMVSSMEVEATHKHYLTLLSYVGCVISALACVFTIAAYLCTRRKSRDYTIKVHMNLLL AVFLLDVSFLLSEPVALMGSEAACRTSAMFLHFSLLACLSWMGLEGYNLYRLVVEVFGTY VPGYLLKLSTVGWGFPVFLVTLVALVDVNNYGPIILAVRRTPDHVIYPSMCWIRDSVVSY VTNLGLFSLVFLFNMAMLATMVVQILRLRPHSQKWPHVLTLLGLSLVLGLPWALVFFSFA SGTFQLVIIYLFSIMTSFQGFLIFLWYWSMRFQAQGGPSPLKNNSDSAKLPISSGSTSSS RI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gpr56 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
77,252 Da
NCBI Official Full Name
G-protein coupled receptor 56
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor G1
NCBI Official Symbol
Adgrg1
NCBI Official Synonym Symbols
Gpr56
NCBI Protein Information
G-protein coupled receptor 56
UniProt Protein Name
G-protein coupled receptor 56
UniProt Gene Name
Gpr56
UniProt Synonym Gene Names
GPR56 NT; GPR56(N); GPR56 CT; GPR56(C); GPR56 7TM
UniProt Entry Name
GPR56_RAT

NCBI Description

may play a role in cell-cell interaction [RGD, Feb 2006]

Uniprot Description

GPR56: Could be involved in cell-cell interactions. Defects in GPR56 are the cause of bilateral frontoparietal polymicrogyria (BFPP). BFPP is characterized by disorganized cortical lamination that is most severe in frontal cortex. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; Cell adhesion; GPCR, family 2; Membrane protein, integral

Cellular Component: extracellular region; integral to membrane; intracellular; plasma membrane

Molecular Function: collagen binding; extracellular matrix binding; G-protein coupled receptor activity

Biological Process: angiogenesis; brain development; cell adhesion; cell surface receptor linked signal transduction; cerebral cortex radial glia guided migration; cerebral cortex regionalization; G-protein coupled receptor protein signaling pathway; layer formation in the cerebral cortex; negative regulation of cell proliferation; positive regulation of cell adhesion; positive regulation of Rho protein signal transduction; Rho protein signal transduction

Research Articles on Gpr56

Similar Products

Product Notes

The Gpr56 gpr56 (Catalog #AAA7016232) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-687aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gpr56 gpr56 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASPREDFRFC GQRNQTQQST LHYDQTSEPH IFVWNTDESL TIRAPFPAAP DIPYFFPEPR GLYHFCLYWS RHTGRLHLRY GKNDYLLSSR ASNLLCYRKQ EESLKQGAPL VATSVSSWQS PQNTSLPGAP SFIFSFHNAP HKVSHNASVN MCDLKKELQL LSKFLQHPHK ASKRPSAAFI SQQLQNLESK LTSVSFLGDT LSFEENRVNA TVWKLPPTAG LEDLQIHSQQ EEEQSEVQAY SVLLPRAVFQ QTRGRRRDAA KRLLVVDFSS QALFQDKNSS QVLGEKVLGI VVQNTKVTNL SDPVVLTFQH QPQPKNVTLQ CVFWVEDPAS SSTGSWSSEG CETVSRDTQT SCLCNHLTYF AVLMVSSMEV EATHKHYLTL LSYVGCVISA LACVFTIAAY LCTRRKSRDY TIKVHMNLLL AVFLLDVSFL LSEPVALMGS EAACRTSAMF LHFSLLACLS WMGLEGYNLY RLVVEVFGTY VPGYLLKLST VGWGFPVFLV TLVALVDVNN YGPIILAVRR TPDHVIYPSM CWIRDSVVSY VTNLGLFSLV FLFNMAMLAT MVVQILRLRP HSQKWPHVLT LLGLSLVLGL PWALVFFSFA SGTFQLVIIY LFSIMTSFQG FLIFLWYWSM RFQAQGGPSP LKNNSDSAKL PISSGSTSSS RI. It is sometimes possible for the material contained within the vial of "G-protein coupled receptor 56 (Gpr56), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.