Probable G-protein coupled receptor 128 (Gpr128) Recombinant Protein | Gpr128 recombinant protein
Recombinant Mouse Probable G-protein coupled receptor 128 (Gpr128)
Gene Names
Adgrg7; Gpr128; 9130020O16Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable G-protein coupled receptor 128 (Gpr128); Recombinant Mouse Probable G-protein coupled receptor 128 (Gpr128); Gpr128 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
27-785aa; full length protein
Sequence
LGIWRMVIRINRGIFVPVPSIPVQFCRNGGTWQNGRCICTEEWKGLRCTIANFCENSTDG EFTFGSIPVGRYGPSLQTCEPGTLNAGSPKATRLCNVSEFGNIELQNVTKGSCNINLQTL EIQINNQTASAENISREAQVLTADASKLTAQNITSATTVVGQIFGKANNESQAKKTAIAT VSQILDASEDVFQKAAEMDNSKSFSNLIKQMENYSYSQGDQTVVEPNIAIQSVTRDDNSG PSVLFSVQKGSSNSLVSGRILINKTANGLNPDGQTELQILLNTGENRKSCGFMVYQNHKL FQSKTFTATSDFSQKIISSKINESEQQRQNKVSVEMVFNPTYDKRELRLHSYACVYWNFL INDWDTQGCQKTGNTTEFLRCNCSHTTNFAVLMSFKKDYKYPKSLDILSNIGCALSIAGL ALTILFQILTRKIRKTSVTWVLVSLCSSMLIFNLLFVFGIENSNKNLKTSDSDINVKPEN NKIPESDTIETPNPSCTAIAALLHYFLLVTFTWNGLSATQLYFLLIRTMKPLPRHFIIFI SLVGWGVPAIIVGVTIGSIYALSGNKRYWELDYRQEEICWLAVPKDNDYARSPLLWSFII PVTIILITNITIFVIITVKVLWKNNQNLTSTKKVSSLKKVFSTLSIAVVFGVTWILAYAM LISNDDIRIVFSYIFCLFNTTQGLQIFILYTVRTKVFQSEASKILKSLSSSFDRTKPMPS ITPLKLRVRMYNMLRSLPSLNERFRLLEPSGMTEETSLS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gpr128 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
87,684 Da
NCBI Official Full Name
adhesion G-protein coupled receptor G7
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor G7
NCBI Official Symbol
Adgrg7
NCBI Official Synonym Symbols
Gpr128; 9130020O16Rik
NCBI Protein Information
adhesion G-protein coupled receptor G7
UniProt Protein Name
Adhesion G-protein coupled receptor G7
UniProt Gene Name
Adgrg7
UniProt Synonym Gene Names
Gpr128
UniProt Entry Name
AGRG7_MOUSE
Uniprot Description
GPR128: Orphan receptor. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 2; Receptor, GPCR
Cellular Component: integral to membrane; membrane
Molecular Function: G-protein coupled receptor activity; signal transducer activity; transmembrane receptor activity
Biological Process: cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway; signal transduction
Research Articles on Gpr128
Similar Products
Product Notes
The Gpr128 adgrg7 (Catalog #AAA7016076) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-785aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gpr128 adgrg7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGIWRMVIRI NRGIFVPVPS IPVQFCRNGG TWQNGRCICT EEWKGLRCTI ANFCENSTDG EFTFGSIPVG RYGPSLQTCE PGTLNAGSPK ATRLCNVSEF GNIELQNVTK GSCNINLQTL EIQINNQTAS AENISREAQV LTADASKLTA QNITSATTVV GQIFGKANNE SQAKKTAIAT VSQILDASED VFQKAAEMDN SKSFSNLIKQ MENYSYSQGD QTVVEPNIAI QSVTRDDNSG PSVLFSVQKG SSNSLVSGRI LINKTANGLN PDGQTELQIL LNTGENRKSC GFMVYQNHKL FQSKTFTATS DFSQKIISSK INESEQQRQN KVSVEMVFNP TYDKRELRLH SYACVYWNFL INDWDTQGCQ KTGNTTEFLR CNCSHTTNFA VLMSFKKDYK YPKSLDILSN IGCALSIAGL ALTILFQILT RKIRKTSVTW VLVSLCSSML IFNLLFVFGI ENSNKNLKTS DSDINVKPEN NKIPESDTIE TPNPSCTAIA ALLHYFLLVT FTWNGLSATQ LYFLLIRTMK PLPRHFIIFI SLVGWGVPAI IVGVTIGSIY ALSGNKRYWE LDYRQEEICW LAVPKDNDYA RSPLLWSFII PVTIILITNI TIFVIITVKV LWKNNQNLTS TKKVSSLKKV FSTLSIAVVF GVTWILAYAM LISNDDIRIV FSYIFCLFNT TQGLQIFILY TVRTKVFQSE ASKILKSLSS SFDRTKPMPS ITPLKLRVRM YNMLRSLPSL NERFRLLEPS GMTEETSLS. It is sometimes possible for the material contained within the vial of "Probable G-protein coupled receptor 128 (Gpr128), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
