Glucose-dependent insulinotropic receptor (Gpr119) Recombinant Protein | Gpr119 recombinant protein
Recombinant Rat Glucose-dependent insulinotropic receptor (Gpr119)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glucose-dependent insulinotropic receptor (Gpr119); Recombinant Rat Glucose-dependent insulinotropic receptor (Gpr119); Gpr119 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-468aa; full length protein
Sequence
MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISG LVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGL VAGGCIAGLWLISYLIGFLPLGVSIFQQTTYHGPCTFFAVFHPRFVLTLSCAGFFPAVLL FVFFYCDMLKIASVHSQHIRKMEHAGAMVGACRPPRPVNDFKAVRTVSVLIGSFTLSWSP FLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLCHMALGLLAD GSTQPQIETLKGKEERKKVGRKTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDACDTQTLY TCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDTQTLYTCDAQTLYTCDA QTLYTCDAQTLYTCDAQTLYTSSLVTGQTEQTPLKRANMSDPLRTCRG
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gpr119 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,686 Da
NCBI Official Full Name
glucose-dependent insulinotropic receptor
NCBI Official Synonym Full Names
G protein-coupled receptor 119
NCBI Official Symbol
Gpr119
NCBI Protein Information
glucose-dependent insulinotropic receptor
UniProt Protein Name
Glucose-dependent insulinotropic receptor
Protein Family
UniProt Gene Name
Gpr119
UniProt Entry Name
GP119_RAT
NCBI Description
a member of the rhodopsin subgroup of the G protein-coupled receptor superfamily [RGD, Feb 2006]
Uniprot Description
GPR119: Receptor for the endogenous fatty-acid ethanolamide oleoylethanolamide (OEA) and lysophosphatidylcholine (LPC). Functions as a glucose-dependent insulinotropic receptor. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Seems to act through a G(s) mediated pathway. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR
Cellular Component: integral to membrane; plasma membrane; receptor complex
Molecular Function: G-protein coupled receptor activity; phosphatidylcholine binding
Biological Process: G-protein coupled receptor protein signaling pathway; insulin secretion
Research Articles on Gpr119
Similar Products
Product Notes
The Gpr119 gpr119 (Catalog #AAA7016070) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-468aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gpr119 gpr119 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MESSFSFGVI LAVLTILIIA VNALVVVAML LSIYKNDGVG LCFTLNLAVA DTLIGVAISG LVTDQLSSSA QHTQKTLCSL RMAFVTSSAA ASVLTVMLIA FDRYLAIKQP LRYFQIMNGL VAGGCIAGLW LISYLIGFLP LGVSIFQQTT YHGPCTFFAV FHPRFVLTLS CAGFFPAVLL FVFFYCDMLK IASVHSQHIR KMEHAGAMVG ACRPPRPVND FKAVRTVSVL IGSFTLSWSP FLITSIVQVA CHKCCLYQVL EKYLWLLGVG NSLLNPLIYA YWQREVRQQL CHMALGLLAD GSTQPQIETL KGKEERKKVG RKTLYTCDAQ TLYTCDAQTL YTCDAQTLYT CDACDTQTLY TCDAQTLYTC DAQTLYTCDA QTLYTCDAQT LYTCDAQTLY TCDTQTLYTC DAQTLYTCDA QTLYTCDAQT LYTCDAQTLY TSSLVTGQTE QTPLKRANMS DPLRTCRG. It is sometimes possible for the material contained within the vial of "Glucose-dependent insulinotropic receptor (Gpr119), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
