ATP-dependent zinc metalloprotease FTSH 10 (FTSH10) Recombinant Protein | FTSH10 recombinant protein
Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 10, mitochondrial (FTSH10)
Gene Names
ftsh10; F22G5.10; F22G5_10; FTSH protease 10; ftsh10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent zinc metalloprotease FTSH 10 (FTSH10); Recombinant Arabidopsis thaliana ATP-dependent zinc metalloprotease FTSH 10; mitochondrial (FTSH10); FTSH10 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
87-813aa; full length protein
Sequence
SSQTPKKKNYENYYPKDSKKAPKNEQKSESRDGSKKNENENAGDAFSNEYQNMLIPLMAI ALILSTFSLGSREQQQISFQEFKNKLLEAGLVDHIDVSNKEVAKVYVRSSPKSQTTEEVV QGPGNGVPAKGRGGQYKYYFNIGSVESFEEKLEEAQEAIGVNSHDFVPVTYVSETIWYQE LLRFAPTLLLVATLIFGARRMQGGLGGLGGPGGKAGRGIFNIGKAQITRADKNSKNKIYF KDVAGCEEAKQEIMEFVHFLQNPKKYEDLGAKIPKGALLVGPPGTGKTLLAKATAGESAV PFLSISGSDFMEMFVGVGPSRVRNLFQEARQCAPSIIFIDEIDAIGRARGRGGFSGGNDE RESTLNQLLVEMDGFGTTAGVVVLAGTNRPDILDKALLRPGRFDRQITIDKPDIKGRDQI FQIYLKKIKLDHEPSYYSQRLAALTPGFAGADIANVCNEAALIAARHEGATVTMAHFDSA IDRVIGGLEKKNRVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQ YVPNENLLMTKEQLFDMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFS DKIGLLSFPQREDEFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELL LEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSGFEESEKESQKESVPVKPVEDDGIPPL EPQVVPT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FTSH10 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
89,555 Da
NCBI Official Full Name
FTSH protease 10
NCBI Official Symbol
ftsh10
NCBI Official Synonym Symbols
F22G5.10; F22G5_10; FTSH protease 10; ftsh10
NCBI Protein Information
FTSH protease 10
UniProt Protein Name
ATP-dependent zinc metalloprotease FTSH 10, mitochondrial
Protein Family
UniProt Gene Name
FTSH10
UniProt Synonym Gene Names
AtFTSH10
UniProt Entry Name
FTSHA_ARATH
NCBI Description
encodes an FtsH protease that is localized to the mitochondrion
Uniprot Description
Probable ATP-dependent zinc metallopeptidase. Involved in the assembly and/or stability of the complexes I and V of the mitochondrial oxidative phosphorylation system.
Similar Products
Product Notes
The FTSH10 ftsh10 (Catalog #AAA7015278) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 87-813aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FTSH10 ftsh10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSQTPKKKNY ENYYPKDSKK APKNEQKSES RDGSKKNENE NAGDAFSNEY QNMLIPLMAI ALILSTFSLG SREQQQISFQ EFKNKLLEAG LVDHIDVSNK EVAKVYVRSS PKSQTTEEVV QGPGNGVPAK GRGGQYKYYF NIGSVESFEE KLEEAQEAIG VNSHDFVPVT YVSETIWYQE LLRFAPTLLL VATLIFGARR MQGGLGGLGG PGGKAGRGIF NIGKAQITRA DKNSKNKIYF KDVAGCEEAK QEIMEFVHFL QNPKKYEDLG AKIPKGALLV GPPGTGKTLL AKATAGESAV PFLSISGSDF MEMFVGVGPS RVRNLFQEAR QCAPSIIFID EIDAIGRARG RGGFSGGNDE RESTLNQLLV EMDGFGTTAG VVVLAGTNRP DILDKALLRP GRFDRQITID KPDIKGRDQI FQIYLKKIKL DHEPSYYSQR LAALTPGFAG ADIANVCNEA ALIAARHEGA TVTMAHFDSA IDRVIGGLEK KNRVISKLER RTVAYHESGH AVAGWFLEHA EPLLKVTIVP RGTAALGFAQ YVPNENLLMT KEQLFDMTCM TLGGRAAEQV LIGRISTGAQ NDLEKVTKMT YAQVAVYGFS DKIGLLSFPQ REDEFSKPYS NRTGAMIDEE VREWVGKAYK RTVELIEEHK EQVAQIAELL LEKEVLHQDD LTKVLGERPF KSGETTNYDR FKSGFEESEK ESQKESVPVK PVEDDGIPPL EPQVVPT. It is sometimes possible for the material contained within the vial of "ATP-dependent zinc metalloprotease FTSH 10 (FTSH10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
