3-ketoacyl-CoA synthase 10 (FDH) Recombinant Protein | FDH recombinant protein
Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 10 (FDH)
Gene Names
KCS10; 3-ketoacyl-CoA synthase 10; FDH; FIDDLEHEAD; KCS10; T1D16.11; T1D16_11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-ketoacyl-CoA synthase 10 (FDH); Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 10 (FDH); FDH recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-550aa; full length protein
Sequence
MGRSNEQDLLSTEIVNRGIEPSGPNAGSPTFSVRVRRRLPDFLQSVNLKYVKLGYHYLIN HAVYLATIPVLVLVFSAEVGSLSREEIWKKLWDYDLATVIGFFGVFVLTACVYFMSRPRS VYLIDFACYKPSDEHKVTKEEFIELARKSGKFDEETLGFKKRILQASGIGDETYVPRSIS SSENITTMKEGREEASTVIFGALDELFEKTRVKPKDVGVLVVNCSIFNPTPSLSAMVINH YKMRGNILSYNLGGMGCSAGIIAIDLARDMLQSNPNSYAVVVSTEMVGYNWYVGSDKSMV IPNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLK ISRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSATA KTNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTLHR FGNTSSSGIWYELAYMEAKESVRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWV DCINRYPVPL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FDH recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,961 Da
NCBI Official Full Name
3-ketoacyl-CoA synthase 10
NCBI Official Symbol
KCS10
NCBI Official Synonym Symbols
3-ketoacyl-CoA synthase 10; FDH; FIDDLEHEAD; KCS10; T1D16.11; T1D16_11
NCBI Protein Information
3-ketoacyl-CoA synthase 10
UniProt Protein Name
3-ketoacyl-CoA synthase 10
Protein Family
UniProt Gene Name
FDH
UniProt Synonym Gene Names
VLCFA condensing enzyme 10
UniProt Entry Name
KCS10_ARATH
NCBI Description
epidermis-specific, encodes KCS10, a putative 3-ketoacyl-CoA synthase. probably involved in the synthesis of long-chain lipids found in the cuticle.
Uniprot Description
Contributes to cuticular wax and suberin biosynthesis. Prevents the postgenital fusion of epiderm cells in organs in contact, as well as ectopic pollen hydration and germination. Required during ovules formation. May regulate an epidermis-specific developmental program during gynoecial ontogeny.
Similar Products
Product Notes
The FDH fdh (Catalog #AAA7014717) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-550aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FDH fdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGRSNEQDLL STEIVNRGIE PSGPNAGSPT FSVRVRRRLP DFLQSVNLKY VKLGYHYLIN HAVYLATIPV LVLVFSAEVG SLSREEIWKK LWDYDLATVI GFFGVFVLTA CVYFMSRPRS VYLIDFACYK PSDEHKVTKE EFIELARKSG KFDEETLGFK KRILQASGIG DETYVPRSIS SSENITTMKE GREEASTVIF GALDELFEKT RVKPKDVGVL VVNCSIFNPT PSLSAMVINH YKMRGNILSY NLGGMGCSAG IIAIDLARDM LQSNPNSYAV VVSTEMVGYN WYVGSDKSMV IPNCFFRMGC SAVMLSNRRR DFRHAKYRLE HIVRTHKAAD DRSFRSVYQE EDEQGFKGLK ISRDLMEVGG EALKTNITTL GPLVLPFSEQ LLFFAALLRR TFSPAAKTST TTSFSTSATA KTNGIKSSSS DLSKPYIPDY KLAFEHFCFH AASKVVLEEL QKNLGLSEEN MEASRMTLHR FGNTSSSGIW YELAYMEAKE SVRRGDRVWQ IAFGSGFKCN SVVWKAMRKV KKPTRNNPWV DCINRYPVPL. It is sometimes possible for the material contained within the vial of "3-ketoacyl-CoA synthase 10 (FDH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
