Fatty acid desaturase 2-like protein FADS2P1 (Fads2p1) Recombinant Protein | Fads2p1 recombinant protein
Recombinant Mouse Fatty acid desaturase 2-like protein FADS2P1 (Fads2p1)
Gene Names
4833423E24Rik; Gm113; Fads2p1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fatty acid desaturase 2-like protein FADS2P1 (Fads2p1); Recombinant Mouse Fatty acid desaturase 2-like protein FADS2P1 (Fads2p1); Fads2p1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-487aa; full length protein
Sequence
MKLEEKLEHNESLVGKSRPCLHDTHQANGKPIANGNPTANGKVEVYEKQEANGKGNRLGK CLNLYTWQEIQRHSQEADQWLVIDRKVYNVTDWAGKHPGGRRVLNHYAGQDATDAFRAMH LDLGMVKLYLKPLLIGELSPEEPSQEKNKNAQLVEDFRELRKTLEAMNMFSANLRFFFLH LAQILILEISAWLILHHFGSSWLVTILISFLLTVSQAQCSFLQHDLGHLSMFKKSKWNHL MHKFVMCHLKGLSADWWNYRHFQHHVKPNIYPKDPDIDVGPLFLVGDTQPIKYGKKKIKY IDYEKQHLYFYMVALPFLMPVYFNLQSMQVMYLRKYWMDIAWVSSFYIRYFITFGPFYGI FGTVLLIYLVKFIESPWIAYVTQMSHIPMKMSSEENHDWLSTQVVATCNIEQSFFNDWFT GHLNFQIEHHLFPTMPRHNYHKVAPLVKSLCAKHGLQYINKPILKAFGDIVRSLKKSASL WMNAYYE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Fads2p1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,082 Da
NCBI Official Full Name
fatty acid desaturase 2-like protein FADS2P1
NCBI Official Synonym Full Names
RIKEN cDNA 4833423E24 gene
NCBI Official Symbol
4833423E24Rik
NCBI Official Synonym Symbols
Gm113; Fads2p1
NCBI Protein Information
fatty acid desaturase 2-like protein FADS2P1
UniProt Protein Name
Fatty acid desaturase 2-like protein FADS2P1
Protein Family
UniProt Gene Name
Fads2p1
UniProt Entry Name
FS2P1_MOUSE
Uniprot Description
4833423E24Rik: Belongs to the fatty acid desaturase family.
Protein type: Oxidoreductase; Membrane protein, integral
Cellular Component: endoplasmic reticulum; integral to membrane; membrane
Molecular Function: metal ion binding; oxidoreductase activity
Biological Process: fatty acid biosynthetic process; fatty acid metabolic process; lipid metabolic process; transport
Similar Products
Product Notes
The Fads2p1 fads2p1 (Catalog #AAA7014492) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-487aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Fads2p1 fads2p1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKLEEKLEHN ESLVGKSRPC LHDTHQANGK PIANGNPTAN GKVEVYEKQE ANGKGNRLGK CLNLYTWQEI QRHSQEADQW LVIDRKVYNV TDWAGKHPGG RRVLNHYAGQ DATDAFRAMH LDLGMVKLYL KPLLIGELSP EEPSQEKNKN AQLVEDFREL RKTLEAMNMF SANLRFFFLH LAQILILEIS AWLILHHFGS SWLVTILISF LLTVSQAQCS FLQHDLGHLS MFKKSKWNHL MHKFVMCHLK GLSADWWNYR HFQHHVKPNI YPKDPDIDVG PLFLVGDTQP IKYGKKKIKY IDYEKQHLYF YMVALPFLMP VYFNLQSMQV MYLRKYWMDI AWVSSFYIRY FITFGPFYGI FGTVLLIYLV KFIESPWIAY VTQMSHIPMK MSSEENHDWL STQVVATCNI EQSFFNDWFT GHLNFQIEHH LFPTMPRHNY HKVAPLVKSL CAKHGLQYIN KPILKAFGDI VRSLKKSASL WMNAYYE. It is sometimes possible for the material contained within the vial of "Fatty acid desaturase 2-like protein FADS2P1 (Fads2p1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
