Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Proteinase-activated receptor 4 (F2RL3) Recombinant Protein | F2RL3 recombinant protein

Recombinant Human Proteinase-activated receptor 4 (F2RL3)

Gene Names
F2RL3; PAR4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proteinase-activated receptor 4 (F2RL3); Recombinant Human Proteinase-activated receptor 4 (F2RL3); F2RL3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
48-385aa; full length protein
Sequence
GYPGQVCANDSDTLELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAP RLPSTMLLMNLAAADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLL AAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVL CHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAV VLASAVAFFVPSNLLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEF RDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for F2RL3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,133 Da
NCBI Official Full Name
proteinase-activated receptor 4
NCBI Official Synonym Full Names
F2R like thrombin/trypsin receptor 3
NCBI Official Symbol
F2RL3
NCBI Official Synonym Symbols
PAR4
NCBI Protein Information
proteinase-activated receptor 4
UniProt Protein Name
Proteinase-activated receptor 4
UniProt Gene Name
F2RL3
UniProt Synonym Gene Names
PAR4; PAR-4
UniProt Entry Name
PAR4_HUMAN

NCBI Description

Coagulation factor II (thrombin) receptor-like 3 (F2RL3) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL3 is also a member of the protease-activated receptor family. F2RL3 is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. F2RL3 is activated by thrombin and trypsin. [provided by RefSeq, Jul 2008]

Uniprot Description

PAR4: a G-protein coupled receptor for activated thrombin or trypsin. Coupled to G proteins that stimulate phosphoinositide hydrolysis. Plays a role in platelets activation. Thrombin requires PAR4 for full spreading on a fibrinogen matrix. Widely expressed, with highest levels in lung, pancreas, thyroid, testis and small intestine. Not expressed in brain, kidney, spinal cord and peripheral blood leukocytes. Also detected in platelets. A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p12

Cellular Component: extracellular region; integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; thrombin receptor activity

Biological Process: blood coagulation; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); platelet activation; platelet dense granule organization and biogenesis; positive regulation of release of sequestered calcium ion into cytosol; response to wounding; signal transduction

Research Articles on F2RL3

Similar Products

Product Notes

The F2RL3 f2rl3 (Catalog #AAA7014455) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 48-385aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the F2RL3 f2rl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GYPGQVCAND SDTLELPDSS RALLLGWVPT RLVPALYGLV LVVGLPANGL ALWVLATQAP RLPSTMLLMN LAAADLLLAL ALPPRIAYHL RGQRWPFGEA ACRLATAALY GHMYGSVLLL AAVSLDRYLA LVHPLRARAL RGRRLALGLC MAAWLMAAAL ALPLTLQRQT FRLARSDRVL CHDALPLDAQ ASHWQPAFTC LALLGCFLPL LAMLLCYGAT LHTLAASGRR YGHALRLTAV VLASAVAFFV PSNLLLLLHY SDPSPSAWGN LYGAYVPSLA LSTLNSCVDP FIYYYVSAEF RDKVRAGLFQ RSPGDTVASK ASAEGGSRGM GTHSSLLQ. It is sometimes possible for the material contained within the vial of "Proteinase-activated receptor 4 (F2RL3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.