Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2) Recombinant Protein | ERGIC2 recombinant protein

Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2)

Gene Names
ERGIC2; PTX1; CDA14; Erv41; cd002
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2); Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2); ERGIC2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-377aa; full length protein
Sequence
MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWM KYEYEVDKDFSSKLRINIDITVAMKCQYVGADVLDLAETMVASADGLVYEPTVFDLSPQQ KEWQRMLQLIQSRLQEEHSLQDVIFKSAFKSTSTALPPREDDSSQSPNACRIHGHLYVNK VAGNFHITVGKAIPHPRGHAHLAALVNHESYNFSHRIDHLSFGELVPAIINPLDGTEKIA IDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSL MVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPF EDGHTDNHLPLLENNTH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ERGIC2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,549 Da
NCBI Official Full Name
endoplasmic reticulum-Golgi intermediate compartment protein 2
NCBI Official Synonym Full Names
ERGIC and golgi 2
NCBI Official Symbol
ERGIC2
NCBI Official Synonym Symbols
PTX1; CDA14; Erv41; cd002
NCBI Protein Information
endoplasmic reticulum-Golgi intermediate compartment protein 2
UniProt Protein Name
Endoplasmic reticulum-Golgi intermediate compartment protein 2
UniProt Gene Name
ERGIC2
UniProt Synonym Gene Names
ERV41; PTX1
UniProt Entry Name
ERGI2_HUMAN

NCBI Description

ERGIC2, or PTX1, is a ubiquitously expressed nuclear protein that is downregulated in prostate carcinoma (Kwok et al., 2001 [PubMed 11445006]).[supplied by OMIM, Aug 2008]

Uniprot Description

PTX1: Possible role in transport between endoplasmic reticulum and Golgi. Belongs to the ERGIC family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p11.22

Cellular Component: cytoplasm; endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; Golgi apparatus; integral to membrane; intracellular membrane-bound organelle; membrane; nucleolus; nucleus

Molecular Function: protein binding

Biological Process: retrograde vesicle-mediated transport, Golgi to ER

Research Articles on ERGIC2

Similar Products

Product Notes

The ERGIC2 ergic2 (Catalog #AAA7014367) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-377aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ERGIC2 ergic2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRRLNRKKTL SLVKELDAFP KVPESYVETS ASGGTVSLIA FTTMALLTIM EFSVYQDTWM KYEYEVDKDF SSKLRINIDI TVAMKCQYVG ADVLDLAETM VASADGLVYE PTVFDLSPQQ KEWQRMLQLI QSRLQEEHSL QDVIFKSAFK STSTALPPRE DDSSQSPNAC RIHGHLYVNK VAGNFHITVG KAIPHPRGHA HLAALVNHES YNFSHRIDHL SFGELVPAII NPLDGTEKIA IDHNQMFQYF ITVVPTKLHT YKISADTHQF SVTERERIIN HAAGSHGVSG IFMKYDLSSL MVTVTEEHMP FWQFFVRLCG IVGGIFSTTG MLHGIGKFIV EIICCRFRLG SYKPVNSVPF EDGHTDNHLP LLENNTH. It is sometimes possible for the material contained within the vial of "Endoplasmic reticulum-Golgi intermediate compartment protein 2 (ERGIC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.