Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7) Recombinant Protein | Entpd7 recombinant protein
Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7)
Gene Names
Entpd7; LALP1; Lysal2; 1810012B13Rik; 1810020C02Rik; 2810003F23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7); Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7); Entpd7 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-606aa; full length protein
Sequence
MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFIPCVLLLLLIMDLRHWATSLPRDR QYERYLARVGDLEATNTEDPNLNYGLVVDCGSSGSRIFVYFWPRHNGNPHDLLDIKQMRD RNSQPVVKKIKPGISAMADTPEHASDYLRPLLSFAAAHVPVKKHRETPLYILCTAGMRLL PERQQLAILADLVKDLPLEFDFLFSQSQAEVISGKQEGVYAWIGINFVLGRFDHEDESDS DTSVDSAAGRRRTVGILDMGGASLQIAYEVPTSASDLPPKQEEAAKILLAEFNLGCDVQH TEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGL TDMVKRNNQVLHFRGKGDWASCRTLLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSE FFYCTEDVLRIGGHYHGPTFAKAAQDYCGMAWPVLAQRFKNGLFSSHADEHRLKYQCFKS AWMYEVLHEGFHFPYDYPNLQTAQLVYDREVQWTLGAILYKTRFLPLRDLRQGQGGVRPA HGSWLRLSFVYNHYLFFACTLVVLLAIVLYLLRIHRIHRRQTRASAPLDLLWIEQVVPMI GVQVGP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Entpd7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,002 Da
NCBI Official Full Name
ectonucleoside triphosphate diphosphohydrolase 7
NCBI Official Synonym Full Names
ectonucleoside triphosphate diphosphohydrolase 7
NCBI Official Symbol
Entpd7
NCBI Official Synonym Symbols
LALP1; Lysal2; 1810012B13Rik; 1810020C02Rik; 2810003F23Rik
NCBI Protein Information
ectonucleoside triphosphate diphosphohydrolase 7
UniProt Protein Name
Ectonucleoside triphosphate diphosphohydrolase 7
Protein Family
UniProt Gene Name
Entpd7
UniProt Synonym Gene Names
Kiaa4066; Lalp1; NTPDase 7
UniProt Entry Name
ENTP7_MOUSE
Uniprot Description
ENTPD7: Preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP. Belongs to the GDA1/CD39 NTPase family.
Protein type: Membrane protein, integral; EC 3.6.1.-; Hydrolase; Membrane protein, multi-pass
Cellular Component: cytoplasmic vesicle; integral to membrane; membrane; nucleus
Molecular Function: 8-oxo-7,8-dihydroguanine triphosphatase activity; ATP-dependent 5'-3' DNA helicase activity; bis(5'-nucleosyl)-tetraphosphatase activity; dATP pyrophosphohydrolase activity; dihydroneopterin monophosphate phosphatase activity; dihydroneopterin triphosphate pyrophosphohydrolase activity; hydrolase activity; metal ion binding; nucleoside-diphosphatase activity; nucleoside-triphosphatase activity; pyrophosphatase activity; thiamin-pyrophosphatase activity; UDP-2,3-diacylglucosamine hydrolase activity
Biological Process: ribonucleoside diphosphate catabolic process; ribonucleoside triphosphate catabolic process
Research Articles on Entpd7
Similar Products
Product Notes
The Entpd7 entpd7 (Catalog #AAA7014270) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-606aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Entpd7 entpd7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MARISFSYLC PASWYFTVPT VSPFLRQRVA FLGLFFIPCV LLLLLIMDLR HWATSLPRDR QYERYLARVG DLEATNTEDP NLNYGLVVDC GSSGSRIFVY FWPRHNGNPH DLLDIKQMRD RNSQPVVKKI KPGISAMADT PEHASDYLRP LLSFAAAHVP VKKHRETPLY ILCTAGMRLL PERQQLAILA DLVKDLPLEF DFLFSQSQAE VISGKQEGVY AWIGINFVLG RFDHEDESDS DTSVDSAAGR RRTVGILDMG GASLQIAYEV PTSASDLPPK QEEAAKILLA EFNLGCDVQH TEHVYRVYVT TFLGFGGNFA RQRYEDLVLN ETLNKNRLLG QKTGLSPDNP FLDPCLPVGL TDMVKRNNQV LHFRGKGDWA SCRTLLSPLL ARSNTSQASL NGIYQSPIDF NNSEFYGFSE FFYCTEDVLR IGGHYHGPTF AKAAQDYCGM AWPVLAQRFK NGLFSSHADE HRLKYQCFKS AWMYEVLHEG FHFPYDYPNL QTAQLVYDRE VQWTLGAILY KTRFLPLRDL RQGQGGVRPA HGSWLRLSFV YNHYLFFACT LVVLLAIVLY LLRIHRIHRR QTRASAPLDL LWIEQVVPMI GVQVGP. It is sometimes possible for the material contained within the vial of "Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
