Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2) Recombinant Protein | EMR2 recombinant protein

Recombinant Human EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2)

Gene Names
ADGRE2; VBU; EMR2; CD312
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2); Recombinant Human EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2); EMR2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-823aa; full length protein
Sequence
QDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFS DCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSY TCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPN GPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMT FSTWTPPPGVHSQTLSRFFDKVQDLGRDYKPGLANNTIQSILQALDELLEAPGDLETLPR LQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAV MQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLVLEPEKQMLLHETHQGLLQDGSPI LLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQNGCGHWATTGCSTI GTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVITYMGLSVSLLCLLLAALTFLLCKA IQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEALY LFLTARNLTVVNYSSINRFMKKLMFPVGYGVPAVTVAISAASRPHLYGTPSRCWLQPEKG FIWGFLGPVCAIFSVNLVLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFKATAQLFILGC TWCLGILQVGPAARVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTES EMHTLSSSAKADTSKPSTVN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for EMR2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,079 Da
NCBI Official Full Name
adhesion G protein-coupled receptor E2 isoform h
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor E2
NCBI Official Symbol
ADGRE2
NCBI Official Synonym Symbols
VBU; EMR2; CD312
NCBI Protein Information
adhesion G protein-coupled receptor E2
UniProt Protein Name
Adhesion G protein-coupled receptor E2
UniProt Gene Name
ADGRE2
UniProt Entry Name
AGRE2_HUMAN

NCBI Description

This gene encodes a member of the class B seven-span transmembrane (TM7) subfamily of G-protein coupled receptors. These proteins are characterized by an extended extracellular region with a variable number of N-terminal epidermal growth factor-like domains coupled to a TM7 domain via a mucin-like spacer domain. The encoded protein is expressed mainly in myeloid cells where it promotes cell-cell adhesion through interaction with chondroitin sulfate chains. This gene is situated in a cluster of related genes on chromosome 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]

Uniprot Description

EMR2: Cell surface receptor that binds to the chondroitin sulfate moiety of glycosaminoglycan chains and promotes cell attachment. Promotes granulocyte chemotaxis, degranulation and adhesion. In macrophages, promotes the release of inflammatory cytokines, including IL8 and TNF. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 2; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: calcium ion binding; G-protein coupled receptor activity

Biological Process: cell adhesion; cell migration; cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway; inflammatory response

Research Articles on EMR2

Similar Products

Product Notes

The EMR2 adgre2 (Catalog #AAA7014257) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-823aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the EMR2 adgre2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QDSRGCARWC PQDSSCVNAT ACRCNPGFSS FSEIITTPME TCDDINECAT LSKVSCGKFS DCWNTEGSYD CVCSPGYEPV SGAKTFKNES ENTCQDVDEC QQNPRLCKSY GTCVNTLGSY TCQCLPGFKL KPEDPKLCTD VNECTSGQNP CHSSTHCLNN VGSYQCRCRP GWQPIPGSPN GPNNTVCEDV DECSSGQHQC DSSTVCFNTV GSYSCRCRPG WKPRHGIPNN QKDTVCEDMT FSTWTPPPGV HSQTLSRFFD KVQDLGRDYK PGLANNTIQS ILQALDELLE APGDLETLPR LQQHCVASHL LDGLEDVLRG LSKNLSNGLL NFSYPAGTEL SLEVQKQVDR SVTLRQNQAV MQLDWNQAQK SGDPGPSVVG LVSIPGMGKL LAEAPLVLEP EKQMLLHETH QGLLQDGSPI LLSDVISAFL SNNDTQNLSS PVTFTFSHRS VIPRQKVLCV FWEHGQNGCG HWATTGCSTI GTRDTSTICR CTHLSSFAVL MAHYDVQEED PVLTVITYMG LSVSLLCLLL AALTFLLCKA IQNTSTSLHL QLSLCLFLAH LLFLVAIDQT GHKVLCSIIA GTLHYLYLAT LTWMLLEALY LFLTARNLTV VNYSSINRFM KKLMFPVGYG VPAVTVAISA ASRPHLYGTP SRCWLQPEKG FIWGFLGPVC AIFSVNLVLF LVTLWILKNR LSSLNSEVST LRNTRMLAFK ATAQLFILGC TWCLGILQVG PAARVMAYLF TIINSLQGVF IFLVYCLLSQ QVREQYGKWS KGIRKLKTES EMHTLSSSAK ADTSKPSTVN. It is sometimes possible for the material contained within the vial of "EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.