Elongation of very long chain fatty acids protein 1 (Elovl1) Recombinant Protein | Elovl1 recombinant protein
Recombinant Mouse Elongation of very long chain fatty acids protein 1 (Elovl1)
Gene Names
Elovl1; Ssc1; AA407424; BB151133
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Elongation of very long chain fatty acids protein 1 (Elovl1); Recombinant Mouse Elongation of very long chain fatty acids protein 1 (Elovl1); Elovl1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-279aa; full length protein
Sequence
MEAVVNLYHELMKHADPRIQSYPLMGSPLLITSILLTYVYFILSLGPRIMANRKPFQLRG FMIVYNFSLVILSLYIVYEFLMSGWLSTYTWRCDPIDFSNSPEALRMVRVAWLFMLSKVI ELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYL YYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYG TIFFILFSNFWYHSYTKGKRLPRAVQQNGAPATTKVKAN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Elovl1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,678 Da
NCBI Official Full Name
elongation of very long chain fatty acids protein 1 isoform 2
NCBI Official Synonym Full Names
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 1
NCBI Official Symbol
Elovl1
NCBI Official Synonym Symbols
Ssc1; AA407424; BB151133
NCBI Protein Information
elongation of very long chain fatty acids protein 1
UniProt Protein Name
Elongation of very long chain fatty acids protein 1
Protein Family
UniProt Gene Name
Elovl1
UniProt Synonym Gene Names
ELOVL FA elongase 1
UniProt Entry Name
ELOV1_MOUSE
Uniprot Description
ELOVL1: Condensing enzyme that catalyzes the synthesis of both saturated and monounsaturated very long chain fatty acids. Exhibits activity toward saturated C18 to C26 acyl-CoA substrates, with the highest activity towards C22:0 acyl-CoA. Important for saturated C24:0 and monounsaturated C24:1 sphingolipid synthesis. Belongs to the ELO family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; EC 2.3.1.199
Cellular Component: endoplasmic reticulum; integral to membrane; membrane
Molecular Function: fatty acid elongase activity; transferase activity
Biological Process: fatty acid biosynthetic process; fatty acid elongation, saturated fatty acid; fatty acid metabolic process; lipid metabolic process; sphingolipid biosynthetic process; very-long-chain fatty acid biosynthetic process
Research Articles on Elovl1
Similar Products
Product Notes
The Elovl1 elovl1 (Catalog #AAA7014207) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-279aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Elovl1 elovl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEAVVNLYHE LMKHADPRIQ SYPLMGSPLL ITSILLTYVY FILSLGPRIM ANRKPFQLRG FMIVYNFSLV ILSLYIVYEF LMSGWLSTYT WRCDPIDFSN SPEALRMVRV AWLFMLSKVI ELMDTVIFIL RKKDGQVTFL HVFHHSVLPW SWWWGIKIAP GGMGSFHAMI NSSVHVVMYL YYGLSALGPV AQPYLWWKKH MTAIQLIQFV LVSLHISQYY FMPSCNYQYP IIIHLIWMYG TIFFILFSNF WYHSYTKGKR LPRAVQQNGA PATTKVKAN. It is sometimes possible for the material contained within the vial of "Elongation of very long chain fatty acids protein 1 (Elovl1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
