Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

D(1A) dopamine receptor (Drd1) Recombinant Protein | Drd1 recombinant protein

Recombinant Rat D (1A) dopamine receptor

Gene Names
Drd1; D1a; Drd-1; Drd1a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
D(1A) dopamine receptor (Drd1); Recombinant Rat D (1A) dopamine receptor; Drd1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-446aa; full length protein
Sequence
MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF FVISLAVSDLLVAVLVMPWKAVAEIAGFWPLGPFCNIWVAFDIMCSTASILNLCVISVDR YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED TEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN CQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL SVILDYDTDVSLEKIQPVTHSGQHST
Sequence Length
446
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Drd1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
49,428 Da
NCBI Official Full Name
D(1A) dopamine receptor
NCBI Official Synonym Full Names
dopamine receptor D1
NCBI Official Symbol
Drd1
NCBI Official Synonym Symbols
D1a; Drd-1; Drd1a
NCBI Protein Information
D(1A) dopamine receptor
UniProt Protein Name
D(1A) dopamine receptor
Protein Family
UniProt Gene Name
Drd1
UniProt Synonym Gene Names
Drd1a
UniProt Entry Name
DRD1_RAT

NCBI Description

induces dopamine sensitive adenylate cyclase activation; plays a role in regulating food intake [RGD, Feb 2006]

Uniprot Description

DRD1: a G-protein coupled receptor.One of the five types (D1 to D5) of receptors for dopamine. The most abundant dopamine receptor in the central nervous system. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Interacts with calcyon.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1

Cellular Component: axon; caveola; cell soma; cytosol; dendrite; dendritic shaft; dendritic spine; endomembrane system; endoplasmic reticulum; endoplasmic reticulum membrane; integral to membrane; integral to plasma membrane; membrane; nerve terminal; nonmotile primary cilium; nucleus; plasma membrane

Molecular Function: angiotensin receptor binding; ATPase binding; D3 dopamine receptor binding; dopamine binding; dopamine D1 receptor-like receptor activity; dopamine receptor activity; drug binding; G-protein alpha-subunit binding; G-protein coupled receptor activity; protein binding; protein complex binding; protein heterodimerization activity; protein phosphatase binding; receptor binding

Biological Process: adenylate cyclase activation; adult walking behavior; associative learning; astrocyte development; behavioral fear response; behavioral response to cocaine; calcium-mediated signaling; cellular response to insulin stimulus; cerebral cortex GABAergic interneuron migration; conditioned taste aversion; dentate gyrus development; dopamine receptor signaling pathway; dopamine receptor, adenylate cyclase activating pathway; dopamine receptor, phospholipase C activating pathway; dopamine transport; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); feeding behavior; G-protein coupled receptor protein signaling pathway; G-protein signaling, adenylate cyclase activating pathway; G-protein signaling, coupled to cyclic nucleotide second messenger; generation of action potential; glucose import; grooming behavior; habituation; hippocampus development; intracellular protein transport; learning; locomotory behavior; maternal behavior; mating behavior; memory; muscle contraction; negative regulation of cell migration; negative regulation of circadian sleep/wake cycle, sleep; negative regulation of protein kinase activity; operant conditioning; orbitofrontal cortex development; peristalsis; phosphatidylinositol catabolic process; phosphatidylinositol metabolic process; positive regulation of adenylate cyclase activity; positive regulation of cAMP biosynthetic process; positive regulation of cell migration; positive regulation of membrane potential; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of synaptic transmission, glutamatergic; prepulse inhibition; protein import into nucleus; regulation of dopamine metabolic process; regulation of ion transport; regulation of long-term neuronal synaptic plasticity; regulation of vasoconstriction; response to activity; response to amino acid stimulus; response to amphetamine; response to cocaine; response to drug; response to estradiol stimulus; response to ethanol; response to food; response to morphine; response to nicotine; response to organic cyclic substance; response to organic nitrogen; response to retinoic acid; response to steroid hormone stimulus; sensitization; social behavior; startle response; striatum development; synaptic transmission, dopaminergic; synaptogenesis; thermoregulation; transmission of nerve impulse; vasodilation; visual learning

Research Articles on Drd1

Similar Products

Product Notes

The Drd1 drd1 (Catalog #AAA7013889) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-446aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Drd1 drd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAPNTSTMDE AGLPAERDFS FRILTACFLS LLILSTLLGN TLVCAAVIRF RHLRSKVTNF FVISLAVSDL LVAVLVMPWK AVAEIAGFWP LGPFCNIWVA FDIMCSTASI LNLCVISVDR YWAISSPFQY ERKMTPKAAF ILISVAWTLS VLISFIPVQL SWHKAKPTWP LDGNFTSLED TEDDNCDTRL SRTYAISSSL ISFYIPVAIM IVTYTSIYRI AQKQIRRISA LERAAVHAKN CQTTAGNGNP VECAQSESSF KMSFKRETKV LKTLSVIMGV FVCCWLPFFI SNCMVPFCGS EETQPFCIDS ITFDVFVWFG WANSSLNPII YAFNADFQKA FSTLLGCYRL CPTTNNAIET VSINNNGAVV FSSHHEPRGS ISKDCNLVYL IPHAVGSSED LKKEEAGGIA KPLEKLSPAL SVILDYDTDV SLEKIQPVTH SGQHST. It is sometimes possible for the material contained within the vial of "D(1A) dopamine receptor (Drd1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.