Dopamine receptor 1 (DopR) Recombinant Protein | DopR recombinant protein
Recombinant Drosophila melanogaster Dopamine receptor 1 (DopR)
Gene Names
Dop1R1; CG9652; D-Dop1; DA1; dDA1; dDA1/DmDOP1; Dmdop1; DmDop1; DmDOP1; DmelCG9652; DopR; DopR1; DopR35F; DR1; dumb
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dopamine receptor 1 (DopR); Recombinant Drosophila melanogaster Dopamine receptor 1 (DopR); DopR recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
20-511aa; full length protein
Sequence
MRAIAAIAAGVGSVAATVATSTTSSISSSTTIINTSSATTIGGNHTSGSTGFSTNSTLLD ADHLPLQLTTAKVDLDIEIDIQLLTNGYDGTTLTSFYNESSWTNASEMDTIVGEEPEPLS LVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTF AGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRV AVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISF YFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHT HSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNS AFNPIIYSIFNKEFRDAFKRILTMRNPWCCAQDVGNIHPRNSDRFITDYAAKNVVVMNSG RSSAELEQVSAI
Sequence Length
511
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for DopR recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,894 Da
NCBI Official Full Name
dopamine 1-like receptor 1, isoform C
NCBI Official Synonym Full Names
Dopamine 1-like receptor 1
NCBI Official Symbol
Dop1R1
NCBI Official Synonym Symbols
CG9652; D-Dop1; DA1; dDA1; dDA1/DmDOP1; Dmdop1; DmDop1; DmDOP1; DmelCG9652; DopR; DopR1; DopR35F; DR1; dumb
NCBI Protein Information
CG9652 gene product from transcript CG9652-RD
UniProt Protein Name
Dopamine receptor 1
UniProt Gene Name
Dop1R1
UniProt Synonym Gene Names
DopR; DopR1; DopR35EF; D-DOP1; DmDop1; dDA1
UniProt Entry Name
DOPR1_DROME
Uniprot Description
Receptor for dopamine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Might be involved in the processing of visual information and/or visual learning. Important for Pavlovian conditioning: required in the mushroom body as a receptor conveying unconditional stimuli information, has a role in memory formation for aversive and appetitive learning. Sleep-deprivation-induced impairments in learning can be partially explained through alterations in dopamine signaling, Dop1R1 expression levels are reduced; sleep may have a role in restoring dopamine homeostasis.
Research Articles on DopR
Similar Products
Product Notes
The DopR dop1r1 (Catalog #AAA7013843) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-511aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the DopR dop1r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRAIAAIAAG VGSVAATVAT STTSSISSST TIINTSSATT IGGNHTSGST GFSTNSTLLD ADHLPLQLTT AKVDLDIEID IQLLTNGYDG TTLTSFYNES SWTNASEMDT IVGEEPEPLS LVSIVVVGIF LSVLIFLSVA GNILVCLAIY TERSLRRIGN LFLASLAIAD LFVASLVMTF AGVNDLLGYW IFGAQFCDTW VAFDVMCSTA SILNLCAISM DRYIHIKDPL RYGRWVTRRV AVITIAAIWL LAAFVSFVPI SLGIHRPDQP LIFEDNGKKY PTCALDLTPT YAVVSSCISF YFPCVVMIGI YCRLYCYAQK HVKSIKAVTR PGEVAEKQRY KSIRRPKNQP KKFKVRNLHT HSSPYHVSDH KAAVTVGVIM GVFLICWVPF FCVNITAAFC KTCIGGQTFK ILTWLGYSNS AFNPIIYSIF NKEFRDAFKR ILTMRNPWCC AQDVGNIHPR NSDRFITDYA AKNVVVMNSG RSSAELEQVS AI. It is sometimes possible for the material contained within the vial of "Dopamine receptor 1 (DopR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
