Derlin-1 (Derl1) Recombinant Protein | Derl1 recombinant protein

Recombinant Mouse Derlin-1 (Derl1)

Cat. Num. AAA7013710

• Gene Names: Derl1; AI195141; AW551338; Derlin-1; 1110021N07Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Derlin-1 (Derl1); Recombinant Mouse Derlin-1 (Derl1); Derl1 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-251aa; full length protein
• Sequence: MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATF YFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLFNWICIVITGLAMDMQL LMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH NWGQGFRLGDQ
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Mouse
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for Derl1 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 13195638
• NCBI GeneID: 67819
• NCBI Accession #: NP_077169.1
• NCBI GenBank Nucleotide #: NM_024207.4
• UniProt Accession #: Q99J56; Q3U6Z2; Q9D918
• Molecular Weight: 28,835 Da
• NCBI Official Full Name: derlin-1
• NCBI Official Synonym Full Names: Der1-like domain family, member 1
• NCBI Official Symbol: Derl1
• NCBI Official Synonym Symbols: AI195141; AW551338; Derlin-1; 1110021N07Rik
• NCBI Protein Information: derlin-1
• UniProt Protein Name: Derlin-1
• Protein Family: Probable derlin
• UniProt Gene Name: Derl1
• UniProt Synonym Gene Names: Der1
• UniProt Entry Name: DERL1_MOUSE

Uniprot Description

DERL1: Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and the degradation substrate. In case of infection by cytomegaloviruses, it plays a central role in the export from the ER and subsequent degradation of MHC class I heavy chains via its interaction with US11 viral protein, which recognizes and associates with MHC class I heavy chains. Also participates in the degradation process of misfolded cytomegalovirus US2 protein. Forms homo- and heterooligomers with DERL2 and DERL3; binding to DERL3 is poorer than that between DERL2 and DERL3. Interacts with AMFR, VIMP/SELS, SEL1L, SYVN1 and VCP, as well as with SEL1L-SYVN1 and VCP-VIMP protein complexes; this interaction is weaker than that observed between DERL2 and these complexes. Interacts with the cytomegalovirus US11 protein. Interacts with NGLY1 and YOD1. Does not bind to EDEM1. Interacts with RNF103. Up-regulated in response to endoplasmic reticulum stress via the ERN1-XBP1 pathway of the unfolded protein response (UPR). Ubiquitous. Belongs to the derlin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Endoplasmic reticulum; Membrane protein, integral; Chaperone

Cellular Component: early endosome; endoplasmic reticulum; integral to endoplasmic reticulum membrane; integral to membrane; late endosome; membrane

Molecular Function: ATPase binding; MHC class I protein binding; protease binding; protein binding; ubiquitin protein ligase binding

Biological Process: ER-associated protein catabolic process; positive regulation of protein binding; positive regulation of protein ubiquitination; protein destabilization; protein homooligomerization; protein transport; response to unfolded protein; retrograde protein transport, ER to cytosol; transport; unfolded protein response