Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome b-245 heavy chain (Cybb) Recombinant Protein | Cybb recombinant protein

Recombinant Mouse Cytochrome b-245 heavy chain (Cybb)

Gene Names
Cybb; Cgd; Cyd; Nox2; C88302; gp91-1; gp91phox; CGD91-phox
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b-245 heavy chain (Cybb); Recombinant Mouse Cytochrome b-245 heavy chain (Cybb); Cybb recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-570aa; full length protein
Sequence
MGNWAVNEGLSIFVILVWLGLNVFLFINYYKVYDDGPKYNYTRKLLGSALALARAPAACL NFNCMLILLPVCRNLLSFLRGSSACCSTRIRRQLDRNLTFHKMVAWMIALHTAIHTIAHL FNVEWCVNARVGISDRYSIALSDIGDNENEEYLNFAREKIKNPEGGLYVAVTRLAGITGI VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAESLEEHN LDICADKIEEWGKIKECPVPKFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL KSVWYKYCDNATSLKLKKIYFYWLCRDTHAFEWFADLLQLLETQMQERNNANFLSYNIYL TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASEHPNTTIGVFLCGPE ALAETLSKQSISNSESGPRGVHFIFNKENF
Sequence Length
570
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Cybb recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,305 Da
NCBI Official Full Name
cytochrome b-245 heavy chain
NCBI Official Synonym Full Names
cytochrome b-245, beta polypeptide
NCBI Official Symbol
Cybb
NCBI Official Synonym Symbols
Cgd; Cyd; Nox2; C88302; gp91-1; gp91phox; CGD91-phox
NCBI Protein Information
cytochrome b-245 heavy chain
UniProt Protein Name
Cytochrome b-245 heavy chain
Protein Family
UniProt Gene Name
Cybb
UniProt Synonym Gene Names
Cgd; Cytochrome b558 subunit beta
UniProt Entry Name
CY24B_MOUSE

NCBI Description

This gene encodes the heavy chain component of a heterodimeric transmembrane ion transporter composed of both a heavy and a light chain. This transporter mediates the transfer of electrons from nicotinamide adenine dinucleotide phosphate (NADPH) to oxygen to generate superoxide. This reaction is important in the innate immune response to pathogens. However, increased activity of the encoded protein also leads to the generation of reactive oxygen species that result in oxidative stress and can cause tissue damage. Conversely, loss of function of the related gene in human causes chronic granulomatous disease. Alternative splicing results in multiple transcript variants, although the full-length nature of some of these variants has not been determined. [provided by RefSeq, May 2013]

Uniprot Description

CYBB: Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc. Defects in CYBB are a cause of granulomatous disease,chronic, X-linked (CGD). A disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life- threatening bacterial/fungal infections. Defects in CYBB are a cause of mycobacteriosis atypical X-linked type 2 (AMCBX2). A rare condition characterized by predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections.

Protein type: EC 1.-.-.-; Membrane protein, integral; Mitochondrial; Membrane protein, multi-pass; Oxidoreductase

Cellular Component: cell soma; cytoplasm; dendrite; endoplasmic reticulum; Golgi apparatus; integral to membrane; integral to plasma membrane; intracellular; membrane; mitochondrion; NADPH oxidase complex; nuclear envelope; perinuclear region of cytoplasm; plasma membrane; rough endoplasmic reticulum

Molecular Function: electron carrier activity; F420H2 dehydrogenase activity; FAD binding; heme binding; malolactic enzyme activity; metal ion binding; N-ethylmaleimide reductase activity; oxidoreductase activity; protein binding; protein heterodimerization activity; sulfur oxygenase reductase activity; superoxide-generating NADPH oxidase activity; voltage-gated ion channel activity

Biological Process: hydrogen peroxide biosynthetic process; inflammatory response; innate immune response; ion transport; positive regulation of angiogenesis; positive regulation of tumor necrosis factor biosynthetic process; respiratory burst; response to drug; superoxide metabolic process; superoxide release; transport

Research Articles on Cybb

Similar Products

Product Notes

The Cybb cybb (Catalog #AAA7013378) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-570aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Cybb cybb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGNWAVNEGL SIFVILVWLG LNVFLFINYY KVYDDGPKYN YTRKLLGSAL ALARAPAACL NFNCMLILLP VCRNLLSFLR GSSACCSTRI RRQLDRNLTF HKMVAWMIAL HTAIHTIAHL FNVEWCVNAR VGISDRYSIA LSDIGDNENE EYLNFAREKI KNPEGGLYVA VTRLAGITGI VITLCLILII TSSTKTIRRS YFEVFWYTHH LFVIFFIGLA IHGAERIVRG QTAESLEEHN LDICADKIEE WGKIKECPVP KFAGNPPMTW KWIVGPMFLY LCERLVRFWR SQQKVVITKV VTHPFKTIEL QMKKKGFKME VGQYIFVKCP KVSKLEWHPF TLTSAPEEDF FSIHIRIVGD WTEGLFNACG CDKQEFQDAW KLPKIAVDGP FGTASEDVFS YEVVMLVGAG IGVTPFASIL KSVWYKYCDN ATSLKLKKIY FYWLCRDTHA FEWFADLLQL LETQMQERNN ANFLSYNIYL TGWDESQANH FAVHHDEEKD VITGLKQKTL YGRPNWDNEF KTIASEHPNT TIGVFLCGPE ALAETLSKQS ISNSESGPRG VHFIFNKENF. It is sometimes possible for the material contained within the vial of "Cytochrome b-245 heavy chain (Cybb), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.