RNase E specificity factor CsrD (csrD) Recombinant Protein | csrD recombinant protein
Recombinant Escherichia coli RNase E specificity factor CsrD (csrD)
Gene Names
csrD; ECK3240; JW3221; yhdA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
RNase E specificity factor CsrD (csrD); Recombinant Escherichia coli RNase E specificity factor CsrD (csrD); csrD recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-646aa; full length protein
Sequence
MRLTTKFSAFVTLLTGLTIFVTLLGCSLSFYNAIQYKFSHRVQAVATAIDTHLVSNDFSV LRPQITELMMSADIVRVDLLHGDKQVYTLARNGSYRPVGSSDLFRELSVPLIKHPGMSLR LVYQDPMGNYFHSLMTTAPLTGAIGFIIVMLFLAVRWLQRQLAGQELLETRATRILNGER GSNVLGTIYEWPPRTSSALDTLLREIQNAREQHSRLDTLIRSYAAQDVKTGLNNRLFFDN QLATLLEDQEKVGTHGIVMMIRLPDFNMLSDTWGHSQVEEQFFTLTNLLSTFMMRYPGAL LARYHRSDFAALLPHRTLKEAESIAGQLIKAVDTLPNNKMLDRDDMIHIGICAWRSGQDT EQVMEHAESATRNAGLQGGNSWAIYDDSLPEKGRGNVRWRTLIEQMLSRGGPRLYQKPAV TREGQVHHRELMCRIFDGNEEVSSAEYMPMVLQFGLSEEYDRLQISRLIPLLRYWPEENL AIQVTVESLIRPRFQRWLRDTLMQCEKSQRKRIIIELAEADVGQHISRLQPVIRLVNALG VRVAVNQAGLTLVSTSWIKELNVELLKLHPGLVRNIEKRTENQLLVQSLVEACSGTSTQV YATGVRSRSEWQTLIQRGVTGGQGDFFASSQPLDTNVKKYSQRYSV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for csrD recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
73,339 Da
NCBI Official Full Name
targeting factor for csrBC sRNA degradation
NCBI Official Symbol
csrD
NCBI Official Synonym Symbols
ECK3240; JW3221; yhdA
NCBI Protein Information
targeting factor for csrBC sRNA degradation
UniProt Protein Name
RNase E specificity factor CsrD
Protein Family
UniProt Gene Name
csrD
UniProt Synonym Gene Names
yhdA
UniProt Entry Name
CSRD_ECOLI
NCBI Description
In its c-di-GMP domains CsrD has HRSDF instead of GGDEF and ELM instead of EAL and does not appear to have either diguanylate cyclase or cyclic-di-GMP phosphodiesterase activities and the role of CsrD in csrB/C destabilization does not involve cyclic-di-GMP metabolism (Suzuki, 2006). [More information is available at EcoGene: EG10018]. CsrD controls the degradation of the small RNAs CsrB and CsrC, thereby regulating the activity of CsrA and affecting the expression of CsrA-regulated genes. [More information is available at EcoCyc: EG10018].
Uniprot Description
Serves as a specificity factor required for RNase E-mediated decay of the small global regulatory RNAs CsrB and CsrC, it is probably not a nuclease. Nor does its activity involve c-di-GMP, despite its domain composition. Positively modulates motility gene expression, is also required for curli expression.
Research Articles on csrD
Similar Products
Product Notes
The csrD csrd (Catalog #AAA7013131) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-646aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the csrD csrd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRLTTKFSAF VTLLTGLTIF VTLLGCSLSF YNAIQYKFSH RVQAVATAID THLVSNDFSV LRPQITELMM SADIVRVDLL HGDKQVYTLA RNGSYRPVGS SDLFRELSVP LIKHPGMSLR LVYQDPMGNY FHSLMTTAPL TGAIGFIIVM LFLAVRWLQR QLAGQELLET RATRILNGER GSNVLGTIYE WPPRTSSALD TLLREIQNAR EQHSRLDTLI RSYAAQDVKT GLNNRLFFDN QLATLLEDQE KVGTHGIVMM IRLPDFNMLS DTWGHSQVEE QFFTLTNLLS TFMMRYPGAL LARYHRSDFA ALLPHRTLKE AESIAGQLIK AVDTLPNNKM LDRDDMIHIG ICAWRSGQDT EQVMEHAESA TRNAGLQGGN SWAIYDDSLP EKGRGNVRWR TLIEQMLSRG GPRLYQKPAV TREGQVHHRE LMCRIFDGNE EVSSAEYMPM VLQFGLSEEY DRLQISRLIP LLRYWPEENL AIQVTVESLI RPRFQRWLRD TLMQCEKSQR KRIIIELAEA DVGQHISRLQ PVIRLVNALG VRVAVNQAGL TLVSTSWIKE LNVELLKLHP GLVRNIEKRT ENQLLVQSLV EACSGTSTQV YATGVRSRSE WQTLIQRGVT GGQGDFFASS QPLDTNVKKY SQRYSV. It is sometimes possible for the material contained within the vial of "RNase E specificity factor CsrD (csrD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
