Putative cyclic nucleotide-gated ion channel 8 (CNGC8) Recombinant Protein | CNGC8 recombinant protein
Recombinant Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 8 (CNGC8)
Gene Names
CNGC8; ATCNGC8; CNGC8; cyclic nucleotide gated channel 8; F14P1.12; F14P1_12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative cyclic nucleotide-gated ion channel 8 (CNGC8); Recombinant Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 8 (CNGC8); CNGC8 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-753aa; full length protein
Sequence
MYKSQYISGHREKFVRLDDTDSRVSMSSNATGMKKRSCFGLFNVTSRGGGKTKNTSKSFR EGVKIGSEGLKTIGKSFTSGVTRAVFPEDLRVSEKKIFDPQDKTLLLWNRMFVISCILAV SVDPLFFYLPIVDNSKNCIGIDSKLAVTTTTLRTIIDVFYLTRMALQFRTAYIAPSSRVF GRGELVIDPAKIAERYLTRYFIVDFLAVLPLPQIAVWKFLHGSKGTDVLPTKQALLHIVI TQYIPRFVRFIPLTSELKKTAGAFAEGAWAGAAYYLLWYMLASHITGAFWYMLSVERNDT CLRSACKVQPDPKVCVQILYCGSKLMSSRETDWIKSVPDLFKNNCSAKSDESKFNYGIYS QAVSSGIVSSTTFFSKFCYCLWWGLQNLSTLGQGLQTSTYPGEVLFSIAIAVAGLLLFAL LIGNMQTYLQSLTVRLEEMRIKRRDSEQWMHHRSLPQNLRERVRRYDQYKWLETRGVDEE NIVQSLPKDLRRDIKRHLCLNLVRRVPLFANMDERLLDAICERLKPSLYTESTYIVREGD PVNEMLFIIRGRLESVTTDGGRSGFFNRGLLKEGDFCGEELLTWALDPKAGSNLPSSTRT VKALTEVEAFALEAEELKFVASQFRRLHSRQVQQTFRFYSQQWRTWAACFIQAAWRRHLR RKIAELRRKEEEEEEMDYEDDEYYDDNMGGMVTRSDSSVGSSSTLRSTVFASRFAANALK GHKLRVTESSKSLMNLTKPSEPDFEALDTDDLN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CNGC8 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85,983 Da
NCBI Official Full Name
cyclic nucleotide gated channel 8
NCBI Official Symbol
CNGC8
NCBI Official Synonym Symbols
ATCNGC8; CNGC8; cyclic nucleotide gated channel 8; F14P1.12; F14P1_12
NCBI Protein Information
cyclic nucleotide gated channel 8
UniProt Protein Name
Putative cyclic nucleotide-gated ion channel 8
Protein Family
UniProt Gene Name
CNGC8
UniProt Entry Name
CNGC8_ARATH
NCBI Description
member of Cyclic nucleotide gated channel family
Uniprot Description
Putative cyclic nucleotide-gated ion channel.
Research Articles on CNGC8
Similar Products
Product Notes
The CNGC8 cngc8 (Catalog #AAA7011859) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-753aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CNGC8 cngc8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYKSQYISGH REKFVRLDDT DSRVSMSSNA TGMKKRSCFG LFNVTSRGGG KTKNTSKSFR EGVKIGSEGL KTIGKSFTSG VTRAVFPEDL RVSEKKIFDP QDKTLLLWNR MFVISCILAV SVDPLFFYLP IVDNSKNCIG IDSKLAVTTT TLRTIIDVFY LTRMALQFRT AYIAPSSRVF GRGELVIDPA KIAERYLTRY FIVDFLAVLP LPQIAVWKFL HGSKGTDVLP TKQALLHIVI TQYIPRFVRF IPLTSELKKT AGAFAEGAWA GAAYYLLWYM LASHITGAFW YMLSVERNDT CLRSACKVQP DPKVCVQILY CGSKLMSSRE TDWIKSVPDL FKNNCSAKSD ESKFNYGIYS QAVSSGIVSS TTFFSKFCYC LWWGLQNLST LGQGLQTSTY PGEVLFSIAI AVAGLLLFAL LIGNMQTYLQ SLTVRLEEMR IKRRDSEQWM HHRSLPQNLR ERVRRYDQYK WLETRGVDEE NIVQSLPKDL RRDIKRHLCL NLVRRVPLFA NMDERLLDAI CERLKPSLYT ESTYIVREGD PVNEMLFIIR GRLESVTTDG GRSGFFNRGL LKEGDFCGEE LLTWALDPKA GSNLPSSTRT VKALTEVEAF ALEAEELKFV ASQFRRLHSR QVQQTFRFYS QQWRTWAACF IQAAWRRHLR RKIAELRRKE EEEEEMDYED DEYYDDNMGG MVTRSDSSVG SSSTLRSTVF ASRFAANALK GHKLRVTESS KSLMNLTKPS EPDFEALDTD DLN. It is sometimes possible for the material contained within the vial of "Putative cyclic nucleotide-gated ion channel 8 (CNGC8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
