Dual specificity protein phosphatase CDC14C (CDC14C) Recombinant Protein | CDC14C recombinant protein
Recombinant Human Dual specificity protein phosphatase CDC14C (CDC14C)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dual specificity protein phosphatase CDC14C (CDC14C); Recombinant Human Dual specificity protein phosphatase CDC14C (CDC14C); CDC14C recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-554aa; Full length protein
Sequence
MNEVSSECGKKCEPLGCSSTNGDLQGEAGAVVSIFLRMVPRIKSNEGYGYSNRNWRKENT MHSLDRNIVDGGQALGQWKRKSKGRSSWAAAPHCSPRCSLTSQGVKKMRSSTLQDPRRRD PQDDVYVDITDRLRFAILYSRPKSASNVHYFSIDNELEYENFSEDFGPLNLAMVYRYCCK INKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEAAYRILIFGDTPYI PFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDR FIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDL FFADGSTPTDAIVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAW VRICRPGLVIGPQQQFLVMKQTSLWLEGDYFRQRLKGQENGQHRAAFSKLLSGVDDISIN GVENQDQQEPKPYSDDDEINGVTQGDRSRALKRRRQSKTNDILLPSPLAVLTFTLCSVVI WWIVCDYILPILLF
Sequence Length
554
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CDC14C recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
63,299 Da
NCBI Official Full Name
Dual specificity protein phosphatase CDC14C
UniProt Protein Name
Dual specificity protein phosphatase CDC14C
Protein Family
UniProt Gene Name
CDC14C
UniProt Synonym Gene Names
CDC14B2
UniProt Entry Name
CC14C_HUMAN
Uniprot Description
CDC14C: Dual-specificity phosphatase. Preferentially dephosphorylates proteins modified by proline-directed kinases. Belongs to the protein-tyrosine phosphatase family. Non-receptor class CDC14 subfamily.
Protein type: Protein phosphatase, dual-specificity; Nucleolus; Motility/polarity/chemotaxis; Membrane protein, integral; EC 3.1.3.48; EC 3.1.3.16
Chromosomal Location of Human Ortholog: 7p12.3
Cellular Component: cytoplasm; integral to membrane; nucleolus; nucleus
Molecular Function: protein serine/threonine phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity
Biological Process: anaphase-promoting complex activation
Similar Products
Product Notes
The CDC14C cdc14c (Catalog #AAA7011201) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-554aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CDC14C cdc14c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNEVSSECGK KCEPLGCSST NGDLQGEAGA VVSIFLRMVP RIKSNEGYGY SNRNWRKENT MHSLDRNIVD GGQALGQWKR KSKGRSSWAA APHCSPRCSL TSQGVKKMRS STLQDPRRRD PQDDVYVDIT DRLRFAILYS RPKSASNVHY FSIDNELEYE NFSEDFGPLN LAMVYRYCCK INKKLKSITM LRKKIVHFTG SDQRKQANAA FLVGCYMVIY LGRTPEAAYR ILIFGDTPYI PFRDAAYGSC NFYITLLDCF HAVKKAMQYG FLNFNSFNLD EYEHYEKAEN GDLNWIIPDR FIAFCGPHSR ARLESGYHQH SPETYIQYFK NHNVTTIIRL NKRMYDAKRF TDAGFDHHDL FFADGSTPTD AIVKRFLDIC ENAEGAIAVH CKAGLGRTGT LIACYIMKHY RMTAAETIAW VRICRPGLVI GPQQQFLVMK QTSLWLEGDY FRQRLKGQEN GQHRAAFSKL LSGVDDISIN GVENQDQQEP KPYSDDDEIN GVTQGDRSRA LKRRRQSKTN DILLPSPLAV LTFTLCSVVI WWIVCDYILP ILLF. It is sometimes possible for the material contained within the vial of "Dual specificity protein phosphatase CDC14C (CDC14C), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
