C-C chemokine receptor 1-like protein 1 (Ccr1l1) Recombinant Protein | Ccr1l1 recombinant protein
Recombinant Mouse C-C chemokine receptor 1-like protein 1 (Ccr1l1)
Gene Names
Ccr1l1; Cmkbr1l1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C chemokine receptor 1-like protein 1 (Ccr1l1); Recombinant Mouse C-C chemokine receptor 1-like protein 1 (Ccr1l1); Ccr1l1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-356aa; full length protein
Sequence
MEIPAVTEPSYNTVAKNDFMSGFLCFSINVRAFGITVLTPLYSLVFIIGVIGHVLVVLVL IQHKRLRNMTSIYLFNLAISDLVFLSTLPFWVDYIMKGDWIFGNAMCKFVSGFYYLGLYS DMFFITLLTIDRYLAVVHVVFALRARTVTFGIISSIITWVLAALVSIPCLYVFKSQMEFT YHTCRAILPRKSLIRFLRFQALTMNILGLILPLLAMIICYTRIINVLHRRPNKKKAKVMR LIFVITLLFFLLLAPYYLAAFVSAFEDVLFTPSCLRSQQVDLSLMITEALAYTHCCVNPV IYVFVGKRFRKYLWQLFRRHTAITLPQWLPFLSVDRAQRASATPPSTVEIETSADL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ccr1l1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,849 Da
NCBI Official Full Name
C-C chemokine receptor 1-like protein 1
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 1-like 1
NCBI Official Symbol
Ccr1l1
NCBI Official Synonym Symbols
Cmkbr1l1
NCBI Protein Information
C-C chemokine receptor 1-like protein 1
UniProt Protein Name
C-C chemokine receptor 1-like protein 1
Protein Family
UniProt Gene Name
Ccr1l1
UniProt Synonym Gene Names
Cmkbr1l1
UniProt Entry Name
CC1L1_MOUSE
Uniprot Description
CCR1L1: Probable receptor for a C-C type chemokine. Belongs to the G-protein coupled receptor 1 family.
Protein type: GPCR, family 1
Cellular Component: integral to membrane; membrane; plasma membrane
Molecular Function: C-C chemokine receptor activity; chemokine receptor activity; G-protein coupled receptor activity; signal transducer activity
Biological Process: chemotaxis; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; signal transduction
Similar Products
Product Notes
The Ccr1l1 ccr1l1 (Catalog #AAA7011004) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-356aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ccr1l1 ccr1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEIPAVTEPS YNTVAKNDFM SGFLCFSINV RAFGITVLTP LYSLVFIIGV IGHVLVVLVL IQHKRLRNMT SIYLFNLAIS DLVFLSTLPF WVDYIMKGDW IFGNAMCKFV SGFYYLGLYS DMFFITLLTI DRYLAVVHVV FALRARTVTF GIISSIITWV LAALVSIPCL YVFKSQMEFT YHTCRAILPR KSLIRFLRFQ ALTMNILGLI LPLLAMIICY TRIINVLHRR PNKKKAKVMR LIFVITLLFF LLLAPYYLAA FVSAFEDVLF TPSCLRSQQV DLSLMITEAL AYTHCCVNPV IYVFVGKRFR KYLWQLFRRH TAITLPQWLP FLSVDRAQRA SATPPSTVEI ETSADL. It is sometimes possible for the material contained within the vial of "C-C chemokine receptor 1-like protein 1 (Ccr1l1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
