Uncharacterized protein C1orf43 (C1orf43) Recombinant Protein | C1orf43 recombinant protein
Recombinant Human Uncharacterized protein C1orf43 (C1orf43)
Gene Names
C1orf43; NICE-3; S863-3; HSPC012; NS5ATP4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein C1orf43 (C1orf43); Recombinant Human Uncharacterized protein C1orf43 (C1orf43); C1orf43 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-253aa; full length protein
Sequence
MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE EIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSE GRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQ EALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELK SFKDNYNTLESTL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for C1orf43 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,203 Da
NCBI Official Full Name
uncharacterized protein C1orf43 isoform 3
NCBI Official Synonym Full Names
chromosome 1 open reading frame 43
NCBI Official Symbol
C1orf43
NCBI Official Synonym Symbols
NICE-3; S863-3; HSPC012; NS5ATP4
NCBI Protein Information
uncharacterized protein C1orf43
UniProt Protein Name
Uncharacterized protein C1orf43
UniProt Gene Name
C1orf43
UniProt Synonym Gene Names
NICE3; NS5ATP4; HCV NS5A-transactivated protein 4
UniProt Entry Name
CA043_HUMAN
Uniprot Description
Nice-3: 5 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 1q21.2
Cellular Component: integral to membrane
Molecular Function: oxidoreductase activity
Research Articles on C1orf43
Similar Products
Product Notes
The C1orf43 c1orf43 (Catalog #AAA7010548) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-253aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the C1orf43 c1orf43 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASGSNWLSG VNVVLVMAYG SLVFVLLFIF VKRQIMRFAM KSRRGPHVPV GHNAPKDLKE EIDIRLSRVQ DIKYEPQLLA DDDARLLQLE TQGNQSCYNY LYRMKALDAI RTSEIPFHSE GRHPRSLMGK NFRSYLLDLR NTSTPFKGVR KALIDTLLDG YETARYGTGV FGQNEYLRYQ EALSELATAV KARIGSSQRH HQSAAKDLTQ SPEVSPTTIQ VTYLPSSQKS KRAKHFLELK SFKDNYNTLE STL. It is sometimes possible for the material contained within the vial of "Uncharacterized protein C1orf43 (C1orf43), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
