Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Autophagy-related protein 9A (Atg9a) Recombinant Protein | Atg9a recombinant protein

Recombinant Mouse Autophagy-related protein 9A (Atg9a)

Gene Names
Atg9a; Atg9; Apg9l1; Atg9l1; AU019532
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Autophagy-related protein 9A (Atg9a); Recombinant Mouse Autophagy-related protein 9A (Atg9a); Atg9a recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-551aa; full length protein
Sequence
MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDLFFSRVYNLHQKNGFT CMLIGEMFELMQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHPTEPVKVTLPDAFLPAQ VCSARIQENGSLITILVIAGVFWIHRLIKFIYNICCYWEIHSFYLHALRIPMSALPYCTW QEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGEV VFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRILWIGIANFLL CPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHELQSRLNRGYKP ASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGVTVTV CRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGVHLGGVAESHRHTPHSHLLPPPSGPG DHRLLPQLYGRGRGCGRHLLLCSDGRSPAWPSSVAVWRADRGLSVPASRGREDRVVAHAL CHHQSRLAAPS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Atg9a recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,138 Da
NCBI Official Full Name
autophagy-related protein 9A isoform a
NCBI Official Synonym Full Names
autophagy related 9A
NCBI Official Symbol
Atg9a
NCBI Official Synonym Symbols
Atg9; Apg9l1; Atg9l1; AU019532
NCBI Protein Information
autophagy-related protein 9A
UniProt Protein Name
Autophagy-related protein 9A
Protein Family
UniProt Gene Name
Atg9a
UniProt Synonym Gene Names
Apg9l1
UniProt Entry Name
ATG9A_MOUSE

Uniprot Description

ATG9A: Plays a role in autophagy. Cycles between a juxta- nuclear trans-Golgi network compartment and late endosomes. Nutrient starvation induces accumulation on autophagosomes. Starvation-dependent trafficking requires ULK1, ATG13 and FAM48A. Interacts with FAM48A. Belongs to the ATG9 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Membrane protein, multi-pass; Membrane protein, integral; Autophagy

Cellular Component: autophagic vacuole; cytoplasm; cytoplasmic vesicle; endosome; Golgi apparatus; integral to membrane; late endosome; membrane; recycling endosome; trans-Golgi network

Biological Process: autophagic vacuole formation; autophagy; innate immune response; mitochondrion degradation; negative regulation of interferon-beta production; protein localization in Golgi apparatus; protein transport; transport

Research Articles on Atg9a

Similar Products

Product Notes

The Atg9a atg9a (Catalog #AAA7008300) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-551aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Atg9a atg9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAQFDTEYQR LEASYSDSPP GEEDLLVHVA EGSKSPWHHI ENLDLFFSRV YNLHQKNGFT CMLIGEMFEL MQFLFVVAFT TFLVSCVDYD ILFANKMVNH SLHPTEPVKV TLPDAFLPAQ VCSARIQENG SLITILVIAG VFWIHRLIKF IYNICCYWEI HSFYLHALRI PMSALPYCTW QEVQARIVQT QKEHQICIHK RELTELDIYH RILRFQNYMV ALVNKSLLPL RFRLPGLGEV VFFTRGLKYN FELILFWGPG SLFLNEWSLK AEYKRGGQRL ELAQRLSNRI LWIGIANFLL CPLILIWQIL YAFFSYAEVL KREPGALGAR CWSLYGRCYL RHFNELEHEL QSRLNRGYKP ASKYMNCFLS PLLTLLAKNG AFFAGSILAV LIALTIYDED VLAVEHVLTT VTLLGVTVTV CRSFIPDQHM VFCPEQLLRV ILAHIHYMPD HWQGVHLGGV AESHRHTPHS HLLPPPSGPG DHRLLPQLYG RGRGCGRHLL LCSDGRSPAW PSSVAVWRAD RGLSVPASRG REDRVVAHAL CHHQSRLAAP S. It is sometimes possible for the material contained within the vial of "Autophagy-related protein 9A (Atg9a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.