ATP-binding cassette sub-family G member 8 (ABCG8) Recombinant Protein | ABCG8 recombinant protein

Recombinant Human ATP-binding cassette sub-family G member 8 (ABCG8)

Cat. Num. AAA7007171

• Gene Names: ABCG8; GBD4; STSL
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP-binding cassette sub-family G member 8 (ABCG8); Recombinant Human ATP-binding cassette sub-family G member 8 (ABCG8); ABCG8 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-673aa; full length protein
• Sequence: MAGKAAEERGLPKGATPQDTSGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLAS QVPWFEQLAQFKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITG RGHGGKIKSGQIWINGQPSSPQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFS QAQRDKRVEDVIAELRLRQCADTRVGNMYVRGLSGGERRRVSIGVQLLWNPGILILDEPT SGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQHM VQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFL WKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLPTLLIH GAEACLMSMTIGFLYFGHGSIQLSFMDTAALLFMIGALIPFNVILDVISKCYSERAMLYY ELEDGLYTTGPYFFAKILGELPEHCAYIIIYGMPTYWLANLRPGLQPFLLHFLLVWLVVF CCRIMALAAAALLPTFHMASFFSNALYNSFYLAGGFMINLSSLWTVPAWISKVSFLRWCF EGLMKIQFSRRTYKMPLGNLTIAVSGDKILSVMELDSYPLYAIYLIVIGLSGGFMVLYYV SLRFIKQKPSQDW
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Human
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for ABCG8 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 11967971
• NCBI GeneID: 64241
• NCBI Accession #: NP_071882.1
• NCBI GenBank Nucleotide #: NM_022437.2
• UniProt Accession #: Q9H221; Q53QN8
• Molecular Weight: 75,592 Da
• NCBI Official Full Name: ATP-binding cassette sub-family G member 8
• NCBI Official Synonym Full Names: ATP binding cassette subfamily G member 8
• NCBI Official Symbol: ABCG8
• NCBI Official Synonym Symbols: GBD4; STSL
• NCBI Protein Information: ATP-binding cassette sub-family G member 8
• UniProt Protein Name: ATP-binding cassette sub-family G member 8
• Protein Family: ABC transporter G family
• UniProt Gene Name: ABCG8
• UniProt Entry Name: ABCG8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions to exclude non-cholesterol sterol entry at the intestinal level, promote excretion of cholesterol and sterols into bile, and to facilitate transport of sterols back into the intestinal lumen. It is expressed in a tissue-specific manner in the liver, intestine, and gallbladder. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG5. Mutations in this gene may contribute to sterol accumulation and atherosclerosis, and have been observed in patients with sitosterolemia. [provided by RefSeq, Jul 2008]

Uniprot Description

ABCG8: Transporter that appears to play an indispensable role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. Genetic variations in ABCG8 can be associated with susceptibility to gallbladder disease type 4 (GBD4). With an overall prevalence of 10-20%, gallstone disease (cholelithiasis) represents one of the most frequent and economically relevant health problems of industrialized countries. Defects in ABCG8 are a cause of sitosterolemia (STSL); also known as phytosterolemia or shellfish sterolemia. It is a rare autosomal recessive disorder characterized by increased intestinal absorption of all sterols including cholesterol, plant and shellfish sterols, and decreased biliary excretion of dietary sterols into bile. Sitosterolemia patients have hypercholesterolemia, very high levels of plant sterols in the plasma, and frequently develop tendon and tuberous xanthomas, accelerated atherosclerosis and premature coronary artery disease. Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, ABC family; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2p21

Cellular Component: apical plasma membrane; ATP-binding cassette (ABC) transporter complex; plasma membrane; receptor complex

Molecular Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; cholesterol transporter activity; protein binding; protein heterodimerization activity

Biological Process: cholesterol absorption; cholesterol efflux; cholesterol homeostasis; excretion; metabolic process; negative regulation of cholesterol absorption; phospholipid transport; response to drug; response to nutrient; sterol transport; transmembrane transport

Disease: Gallbladder Disease 4; Sitosterolemia