Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-binding cassette sub-family G member 5 (Abcg5) Recombinant Protein | Abcg5 recombinant protein

Recombinant Mouse ATP-binding cassette sub-family G member 5 (Abcg5)

Gene Names
Abcg5; cmp; trac; sterolin-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-binding cassette sub-family G member 5 (Abcg5); Recombinant Mouse ATP-binding cassette sub-family G member 5 (Abcg5); Abcg5 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-652aa; full length protein
Sequence
MGELPFLSPEGARGPHINRGSLSSLEQGSVTGTEARHSLGVLHVSYSVSNRVGPWWNIKS CQQKWDRQILKDVSLYIESGQIMCILGSSGSGKTTLLDAISGRLRRTGTLEGEVFVNGCE LRRDQFQDCFSYVLQSDVFLSSLTVRETLRYTAMLALCRSSADFYNKKVEAVMTELSLSH VADQMIGSYNFGGISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANQIVLLLAELA RRDRIVIVTIHQPRSELFQHFDKIAILTYGELVFCGTPEEMLGFFNNCGYPCPEHSNPFD FYMDLTSVDTQSREREIETYKRVQMLECAFKESDIYHKILENIERARYLKTLPTVPFKTK DPPGMFGKLGVLLRRVTRNLMRNKQAVIMRLVQNLIMGLFLIFYLLRVQNNTLKGAVQDR VGLLYQLVGATPYTGMLNAVNLFPMLRAVSDQESQDGLYHKWQMLLAYVLHVLPFSVIAT VIFSSVCYWTLGLYPEVARFGYFSAALLAPHLIGEFLTLVLLGIVQNPNIVNSIVALLSI SGLLIGSGFIRNIQEMPIPLKILGYFTFQKYCCEILVVNEFYGLNFTCGGSNTSMLNHPM CAITQGVQFIEKTCPGATSRFTANFLILYGFIPALVILGIVIFKVRDYLISR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Abcg5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73,244 Da
NCBI Official Full Name
ATP-binding cassette sub-family G member 5
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family G (WHITE), member 5
NCBI Official Symbol
Abcg5
NCBI Official Synonym Symbols
cmp; trac; sterolin-1
NCBI Protein Information
ATP-binding cassette sub-family G member 5
UniProt Protein Name
ATP-binding cassette sub-family G member 5
Protein Family
UniProt Gene Name
Abcg5
UniProt Entry Name
ABCG5_MOUSE

NCBI Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily, and functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. Disruption of this gene in mice results in thrombocytopenia, prolonged bleeding times, anemia, leukopenia, infertility, shortened life span and cardiomyopathy. Mice lacking this gene show symptoms of sitosterolemia. [provided by RefSeq, Nov 2015]

Uniprot Description

ABCG5: Transporter that appears to play an indispensable role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. Defects in ABCG5 are a cause of sitosterolemia (STSL); also known as phytosterolemia or shellfish sterolemia. It is a rare autosomal recessive disorder characterized by increased intestinal absorption of all sterols including cholesterol, plant and shellfish sterols, and decreased biliary excretion of dietary sterols into bile. Sitosterolemia patients have hypercholesterolemia, very high levels of plant sterols in the plasma, and frequently develop tendon and tuberous xanthomas, accelerated atherosclerosis and premature coronary artery disease. Belongs to the ABC transporter superfamily. ABCG family. Eye pigment precursor importer (TC 3.A.1.204) subfamily.

Protein type: Transporter, ABC family; Transporter; Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: apical part of cell; apical plasma membrane; ATP-binding cassette (ABC) transporter complex; integral to membrane; membrane; receptor complex

Molecular Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; cholesterol transporter activity; nucleotide binding; protein heterodimerization activity

Biological Process: cholesterol absorption; cholesterol efflux; cholesterol homeostasis; excretion; negative regulation of cholesterol absorption; transport

Research Articles on Abcg5

Similar Products

Product Notes

The Abcg5 abcg5 (Catalog #AAA7007166) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-652aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Abcg5 abcg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGELPFLSPE GARGPHINRG SLSSLEQGSV TGTEARHSLG VLHVSYSVSN RVGPWWNIKS CQQKWDRQIL KDVSLYIESG QIMCILGSSG SGKTTLLDAI SGRLRRTGTL EGEVFVNGCE LRRDQFQDCF SYVLQSDVFL SSLTVRETLR YTAMLALCRS SADFYNKKVE AVMTELSLSH VADQMIGSYN FGGISSGERR RVSIAAQLLQ DPKVMMLDEP TTGLDCMTAN QIVLLLAELA RRDRIVIVTI HQPRSELFQH FDKIAILTYG ELVFCGTPEE MLGFFNNCGY PCPEHSNPFD FYMDLTSVDT QSREREIETY KRVQMLECAF KESDIYHKIL ENIERARYLK TLPTVPFKTK DPPGMFGKLG VLLRRVTRNL MRNKQAVIMR LVQNLIMGLF LIFYLLRVQN NTLKGAVQDR VGLLYQLVGA TPYTGMLNAV NLFPMLRAVS DQESQDGLYH KWQMLLAYVL HVLPFSVIAT VIFSSVCYWT LGLYPEVARF GYFSAALLAP HLIGEFLTLV LLGIVQNPNI VNSIVALLSI SGLLIGSGFI RNIQEMPIPL KILGYFTFQK YCCEILVVNE FYGLNFTCGG SNTSMLNHPM CAITQGVQFI EKTCPGATSR FTANFLILYG FIPALVILGI VIFKVRDYLI SR. It is sometimes possible for the material contained within the vial of "ATP-binding cassette sub-family G member 5 (Abcg5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.