ABC transporter G family member 19 (ABCG19) Recombinant Protein | ABCG19 recombinant protein
Recombinant Arabidopsis thaliana ABC transporter G family member 19 (ABCG19)
Gene Names
WBC19; ATWBC19; WBC19; white-brown complex homolog 19
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ABC transporter G family member 19 (ABCG19); Recombinant Arabidopsis thaliana ABC transporter G family member 19 (ABCG19); ABCG19 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-725aa; full length protein
Sequence
MNLSLSGRKIAMTRVSAETQYITPIGSPTLDELLKDCDSFRKGDSGDGVKSDDPAHHIID VEALYVKPVPYVLNFNNLQYDVTLRRRFGFSRQNGVKTLLDDVSGEASDGDILAVLGASG AGKSTLIDALAGRVAEGSLRGSVTLNGEKVLQSRLLKVISAYVMQDDLLFPMLTVKETLM FASEFRLPRSLSKSKKMERVEALIDQLGLRNAANTVIGDEGHRGVSGGERRRVSIGIDII HDPIVLFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSR GKSVFNGSPASLPGFFSDFGRPIPEKENISEFALDLVRELEGSNEGTKALVDFNEKWQQN KISLIQSAPQTNKLDQDRSLSLKEAINASVSRGKLVSGSSRSNPTSMETVSSYANPSLFE TFILAKRYMKNWIRMPELVGTRIATVMVTGCLLATVYWKLDHTPRGAQERLTLFAFVVPT MFYCCLDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLLAPSLVFSAITFWTV GLSGGLEGFVFYCLLIYASFWSGSSVVTFISGVVPNIMLCYMVSITYLAYCLLLSGFYVN RDRIPFYWTWFHYISILKYPYEAVLINEFDDPSRCFVRGVQVFDSTLLGGVSDSGKVKLL ETLSKSLRTKITESTCLRTGSDLLAQQGITQLSKWDCLWITFASGLFFRILFYFALLFGS RNKRT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ABCG19 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,657 Da
NCBI Official Full Name
ABC transporter G family member 19
NCBI Official Symbol
WBC19
NCBI Official Synonym Symbols
ATWBC19; WBC19; white-brown complex homolog 19
NCBI Protein Information
ABC transporter G family member 19
UniProt Protein Name
ABC transporter G family member 19
Protein Family
UniProt Gene Name
ABCG19
UniProt Synonym Gene Names
WBC19; ABC transporter ABCG.19; AtABCG19; AtWBC19
UniProt Entry Name
AB19G_ARATH
NCBI Description
Encodes a vacuole localized protein of the ABC transporter White-Brown Complex (WBC) family. When overexpressed in planta, confers resistance to kanamycin.
Uniprot Description
Confers selective resistance to kanamycin.
Research Articles on ABCG19
Similar Products
Product Notes
The ABCG19 abcg19 (Catalog #AAA7007143) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-725aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ABCG19 abcg19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNLSLSGRKI AMTRVSAETQ YITPIGSPTL DELLKDCDSF RKGDSGDGVK SDDPAHHIID VEALYVKPVP YVLNFNNLQY DVTLRRRFGF SRQNGVKTLL DDVSGEASDG DILAVLGASG AGKSTLIDAL AGRVAEGSLR GSVTLNGEKV LQSRLLKVIS AYVMQDDLLF PMLTVKETLM FASEFRLPRS LSKSKKMERV EALIDQLGLR NAANTVIGDE GHRGVSGGER RRVSIGIDII HDPIVLFLDE PTSGLDSTNA FMVVQVLKRI AQSGSIVIMS IHQPSARIVE LLDRLIILSR GKSVFNGSPA SLPGFFSDFG RPIPEKENIS EFALDLVREL EGSNEGTKAL VDFNEKWQQN KISLIQSAPQ TNKLDQDRSL SLKEAINASV SRGKLVSGSS RSNPTSMETV SSYANPSLFE TFILAKRYMK NWIRMPELVG TRIATVMVTG CLLATVYWKL DHTPRGAQER LTLFAFVVPT MFYCCLDNVP VFIQERYIFL RETTHNAYRT SSYVISHSLV SLPQLLAPSL VFSAITFWTV GLSGGLEGFV FYCLLIYASF WSGSSVVTFI SGVVPNIMLC YMVSITYLAY CLLLSGFYVN RDRIPFYWTW FHYISILKYP YEAVLINEFD DPSRCFVRGV QVFDSTLLGG VSDSGKVKLL ETLSKSLRTK ITESTCLRTG SDLLAQQGIT QLSKWDCLWI TFASGLFFRI LFYFALLFGS RNKRT. It is sometimes possible for the material contained within the vial of "ABC transporter G family member 19 (ABCG19), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
