ccbe1 recombinant protein

Human ccbe1 (fragment)

Cat. Num. AAA692506

• Gene Names: CCBE1; HKLLS1
• Reactivity: Human
• Purity: > 95% by SDS-PAGE & visualized by Coomassie stain
• Synonyms: ccbe1; Human ccbe1 (fragment); ccbe1 (fragment); collagen and calcium binding EGF domains 1; KIAA1983; ccbe1 recombinant protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 95% by SDS-PAGE & visualized by Coomassie stain
• Form/Format: Lyophilized
• Sequence: MCECREGYIREDDGKTCTRGDKYPNDTGHEKSENMVKAGTCCATCKEFYQ MKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLEHHHHH H; N terminal: ECREGYI
• Sequence Length: 406

• Reconstitution: Centrifuge vial prior to opening. The lyophilized ccbe1 is soluble in water and most aqueous buffers and should be reconstituted in PBS to a concentration not lower than 50 ug/ml.
• Tag: His-Tag
• Chromosomal Location: 18q21.32
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C.; Reconstituted ccbe1 should be stored in working aliquots at -20 degree C.

Related Product Information for ccbe1 recombinant protein

The lymphatic system comprises a vascular system separate from the cardiovascular system, essential for immune responses, fluid homeostasis and fat absorption. Lymphatic vessels develop in a complex process termed lymphangiogenesis that involves budding, migration and proliferation of lymphatic endothelial progenitor cells. A few genes, such as FLT4, FOXC2 and SOX18, are known to be critically involved in lymph vessel formation in humans. Lymphedema, lymphangiectasias, mental retardation and unusual facial characteristics define the autosomal recessive Hennekam syndrome. Homozygosity mapping identified a critical chromosomal region containing ccbe1, encoding Collagen and Calcium-Binding EGF-domain-1, a secreted protein which is required for embryonic lymphangiogenesis in zebrafish. ccbe1 is not expressed in endothelial cells of lymph vessels, and it may be a component of the extracellular matrix. In zebrafish, ccbe1 expression was observed along the earliest migra¬tion routes of endothelial cells that sprout from the posterior cardinal vein and migrate circuitously before developing into lymphatic vessels. ccbe1 might therefore be involved in guidance of these migrating cells.

Product Categories/Family for ccbe1 recombinant protein

Cytokines & Growth Factors

NCBI and Uniprot Product Information

• NCBI GI #: 39930511
• NCBI GeneID: 147372
• NCBI Accession #: NP_597716.1
• NCBI GenBank Nucleotide #: NM_133459.3
• UniProt Accession #: Q6UXH8; Q6MZX5; Q86SS2; Q8TF19
• Molecular Weight: 22,600 Da
• NCBI Official Full Name: collagen and calcium-binding EGF domain-containing protein 1
• NCBI Official Synonym Full Names: collagen and calcium binding EGF domains 1
• NCBI Official Symbol: CCBE1
• NCBI Official Synonym Symbols: HKLLS1
• NCBI Protein Information: collagen and calcium-binding EGF domain-containing protein 1
• UniProt Protein Name: Collagen and calcium-binding EGF domain-containing protein 1
• Protein Family: Collagen and calcium-binding EGF domain-containing protein
• UniProt Gene Name: CCBE1
• UniProt Synonym Gene Names: KIAA1983

NCBI Description

This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans. [provided by RefSeq, Mar 2010]

Uniprot Description

Required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis.